SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30006
         (796 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual      31   0.19 
SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase Ogm1|Schi...    27   4.1  
SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    26   7.1  

>SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 188

 Score = 31.1 bits (67), Expect = 0.19
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = +3

Query: 534 FYLLYSHYSVYFFLFTSFAYSFIFTLKFHGDIINL 638
           F+  +S +S + FLFTS  ++F F L  H  ++++
Sbjct: 110 FFFYFSLFSFFSFLFTSLHFNFFFRLCRHKHLLDI 144


>SPAC22A12.07c |ogm1|oma1|protein O-mannosyltransferase
           Ogm1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 893

 Score = 26.6 bits (56), Expect = 4.1
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = -2

Query: 291 VYN*YEP-DMITTVAAQRCRVRLFRGSYVICCNKY 190
           VY  Y P   +TT+    CR    +GS+   CN Y
Sbjct: 683 VYRLYSPFTYMTTLTKSSCRALELKGSWNFHCNTY 717


>SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 230

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 17/59 (28%), Positives = 26/59 (44%)
 Frame = +2

Query: 434 LREVIGAFLMCNACLILDFCNDKLLCISS*TNSFLFIIQSL*CVFFFVHEFCLFVYFYF 610
           L    G+ L    CL+L F         S + SFLF +  +  V+F       F++F+F
Sbjct: 102 LHPFTGSELSLFRCLLLFFFFLLFFLSFSFSFSFLFFLSQIFIVYFSSFPILHFLFFFF 160


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,817,613
Number of Sequences: 5004
Number of extensions: 56432
Number of successful extensions: 104
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 100
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 104
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 387388442
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).