SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30005
         (981 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit |...    30   0.43 
SPBC119.02 |ubc4||ubiquitin conjugating enzyme Ubc4|Schizosaccha...    28   2.3  
SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces pomb...    27   5.3  
SPBC14F5.13c |||alkaline phosphatase |Schizosaccharomyces pombe|...    27   5.3  
SPBC18E5.01 ||SPBC29A3.19|cycloisomerase 2 family|Schizosaccharo...    26   9.3  

>SPAC22E12.19 ||SPAC2E12.01|histone deacetylase complex subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 661

 Score = 30.3 bits (65), Expect = 0.43
 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 4/43 (9%)
 Frame = -1

Query: 849 PNIYQFQSLSTTKN*QQR----QESFFHGKKFFKIQQTRHGPN 733
           P  Y FQS+    N +Q     Q+   HGKKF KI +   G N
Sbjct: 239 PKFYHFQSMPDIWNEEQHSIFVQQFILHGKKFGKIAEAVPGKN 281


>SPBC119.02 |ubc4||ubiquitin conjugating enzyme
           Ubc4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 147

 Score = 27.9 bits (59), Expect = 2.3
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = -3

Query: 856 FFSXHLPISIPFNNQKLTTTARIFFP 779
           F S H P   PF   K+  T RI+ P
Sbjct: 51  FLSIHFPTDYPFKPPKVNFTTRIYHP 76


>SPBC2A9.04c |||sir antagonist ortholog |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 741

 Score = 26.6 bits (56), Expect = 5.3
 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +1

Query: 508 IFLGKP-LKGTASQRKTPSEIIKWEGNR 588
           I+L +P L+   S+++TPSE +  EG R
Sbjct: 492 IYLSRPPLQPAVSEQETPSEAVSREGTR 519


>SPBC14F5.13c |||alkaline phosphatase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 532

 Score = 26.6 bits (56), Expect = 5.3
 Identities = 14/43 (32%), Positives = 22/43 (51%)
 Frame = +3

Query: 210 EIPRAITGKTNGPSEVAVRQELSRKLVHGQQQGRNFIEFLWRP 338
           EI  A   K NG S ++     +  L  G+Q  + + E+LW+P
Sbjct: 334 EIASAFVEK-NGGSLISTSDHETGGLTVGRQVSKKYPEYLWKP 375


>SPBC18E5.01 ||SPBC29A3.19|cycloisomerase 2
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 342

 Score = 25.8 bits (54), Expect = 9.3
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = -2

Query: 230 GYGPRNFTNGSSLPIEQVLCE 168
           GYGPR+     +LP+  ++CE
Sbjct: 171 GYGPRHIVFHKTLPVCYLICE 191


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,836,458
Number of Sequences: 5004
Number of extensions: 78857
Number of successful extensions: 212
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 206
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 212
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 505288058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).