SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30004
         (843 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|...    28   1.4  
SPBC1706.03 |fzo1|SPBC839.01|mitochondrial fusion GTPase protein...    26   7.7  
SPBC776.10c |cog6||Golgi transport complex peripheral subunit Co...    26   7.7  

>SPBC1826.01c |mot1||TATA-binding protein associated factor
            Mot1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1953

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = -1

Query: 222  TKKKKNEEKSFIIQNVSLYSLAPTRRDLRSTIEFVKIIQLY 100
            + K  NE K  II  +S+Y +A  R+D++ +      +  Y
Sbjct: 949  SSKALNEIKYLIIDEISIYKIAKERQDIQCSASIASAMVTY 989


>SPBC1706.03 |fzo1|SPBC839.01|mitochondrial fusion GTPase
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 758

 Score = 25.8 bits (54), Expect = 7.7
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = -1

Query: 210 KNEEKSFIIQNVSLYSLAPTRRDLRSTI 127
           +N  +SFI++N S   LAP RR L   +
Sbjct: 387 ENSLRSFILENRSKSKLAPVRRYLSGLV 414


>SPBC776.10c |cog6||Golgi transport complex peripheral subunit Cog6
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 675

 Score = 25.8 bits (54), Expect = 7.7
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 818 NYISQYDLKHPKWIYQRDALTNYNHRKI*LLNNDVL 711
           NY+ +Y   +  + Y ++  T Y +    LLNND +
Sbjct: 514 NYVGRYTFLNELFEYLQEKTTYYKNNLTTLLNNDYI 549


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,004,052
Number of Sequences: 5004
Number of extensions: 53996
Number of successful extensions: 121
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 118
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 121
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 416455520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).