SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30002
         (748 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC15A10.01 |atm1|SPAC8C9.18|ABC family iron transporter Atm1|S...    28   1.2  
SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S...    27   3.8  
SPCC132.04c |||NAD-dependent glutamate dehydrogenase |Schizosacc...    27   3.8  
SPAC11H11.02c |mug162||sequence orphan|Schizosaccharomyces pombe...    26   6.6  
SPBC3D6.05 |ptp4||phosphatidate cytidylyltransferase Ptp4 |Schiz...    25   8.7  
SPBC18E5.13 ||SPBC23G7.03|translation initiation factor |Schizos...    25   8.7  

>SPAC15A10.01 |atm1|SPAC8C9.18|ABC family iron transporter
           Atm1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 693

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 12/22 (54%), Positives = 14/22 (63%)
 Frame = +3

Query: 132 FDLIHFKYN*RGPILYHITFNI 197
           FD +HF YN   PIL   +FNI
Sbjct: 445 FDNVHFSYNPNRPILNGCSFNI 466


>SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase
           Mok11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2397

 Score = 26.6 bits (56), Expect = 3.8
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = +2

Query: 203 LYLTLVFKYQWCILPF-KLSTDWQTKAQV 286
           LY+ ++ K+ WC  PF  L TDW     V
Sbjct: 11  LYIVILDKHAWC-APFNNLLTDWNLNTNV 38


>SPCC132.04c |||NAD-dependent glutamate dehydrogenase
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1106

 Score = 26.6 bits (56), Expect = 3.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = -2

Query: 447 FSNNVMIVDSNLKSEYSNDTAITLLNFL 364
           FSN V I+  N K E   + A+T +N L
Sbjct: 354 FSNGVTIISYNFKPELFKNAAVTSINEL 381


>SPAC11H11.02c |mug162||sequence orphan|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 264

 Score = 25.8 bits (54), Expect = 6.6
 Identities = 15/64 (23%), Positives = 32/64 (50%)
 Frame = -2

Query: 492 YQFEQL*FYSVGSISFSNNVMIVDSNLKSEYSNDTAITLLNFLKIVVKLYGFFSCKIFVC 313
           Y F+++    +  ISFS        ++KS    +   T+++ ++I +KL+   +  +F+ 
Sbjct: 102 YSFDRVGCMELAFISFSAACYFNIRSIKSLSLKNKNWTIISIIEIPIKLHFILNVLLFLK 161

Query: 312 FRGY 301
           F  Y
Sbjct: 162 FSEY 165


>SPBC3D6.05 |ptp4||phosphatidate cytidylyltransferase Ptp4
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 218

 Score = 25.4 bits (53), Expect = 8.7
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +3

Query: 504 ALVMELGAFISGILCCII 557
           +L   LGAF+ G+ CC +
Sbjct: 141 SLAGSLGAFVCGVFCCYV 158


>SPBC18E5.13 ||SPBC23G7.03|translation initiation factor
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 233

 Score = 25.4 bits (53), Expect = 8.7
 Identities = 11/40 (27%), Positives = 24/40 (60%)
 Frame = +2

Query: 347 SLTTIFKKFKSVIAVSLLYSLFKFESTIMTLFENEIDPTL 466
           SLT++F+K +S   ++  ++  K  ++I   F+  ID ++
Sbjct: 19  SLTSVFRKCQSRTFMNSQFASAKLSNSIKKYFDGRIDESI 58


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,903,144
Number of Sequences: 5004
Number of extensions: 59106
Number of successful extensions: 118
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 118
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 355273338
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).