SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1687.17c |||Der1-like |Schizosaccharomyces pombe|chr 1|||Manual    29   1.1  
SPAC4F8.03 ||SPAC644.01c|SBDS family ribosome maturation protein...    27   2.5  
SPAC959.08 |rpl2102|rpl21-2, rpl21|60S ribosomal protein L21|Sch...    26   5.7  
SPBC365.03c |rpl2101|rpl21, rpl21-1|60S ribosomal protein L21|Sc...    26   5.7  

>SPAC1687.17c |||Der1-like |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 168

 Score = 28.7 bits (61), Expect = 1.1
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +1

Query: 364 VNTQASFLRRYTEVFKFCLHLIQSWRHQHYVICIVKVFQDIFAPF 498
           V +  S++      F F +  I SW+H  Y I I+ +F D+ AP+
Sbjct: 86  VTSYFSYMPFAASYFSFTMLYIWSWKHPLYRISILGLF-DVKAPY 129


>SPAC4F8.03 ||SPAC644.01c|SBDS family ribosome maturation
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 246

 Score = 27.5 bits (58), Expect = 2.5
 Identities = 20/64 (31%), Positives = 28/64 (43%)
 Frame = -3

Query: 309 LQDCGFEVSTEVYISGELLSNQGGSDEDIEIRIRKARGAFAQLKPVWESSVMTRRIKLTL 130
           L DCGF VST      + L       E  EI I +AR     +  V +   +  R++ +L
Sbjct: 137 LSDCGFSVSTSKTAKSQALEAIKKLQEKNEIPIVRARMRIRIVVDVKQGKALRERLR-SL 195

Query: 129 FDSI 118
            D I
Sbjct: 196 ADEI 199


>SPAC959.08 |rpl2102|rpl21-2, rpl21|60S ribosomal protein
           L21|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 160

 Score = 26.2 bits (55), Expect = 5.7
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 686 LVYLFVLSRVHILLHCTVSKRFSQKSTNVRI 778
           +VY    S V +L++  V  R+ +K  NVRI
Sbjct: 63  VVYNVTQSSVGVLIYKVVGNRYMEKRVNVRI 93


>SPBC365.03c |rpl2101|rpl21, rpl21-1|60S ribosomal protein
           L21|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 160

 Score = 26.2 bits (55), Expect = 5.7
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 686 LVYLFVLSRVHILLHCTVSKRFSQKSTNVRI 778
           +VY    S V +L++  V  R+ +K  NVRI
Sbjct: 63  VVYNVTQSSVGVLIYKVVGNRYMEKRVNVRI 93


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,662,186
Number of Sequences: 5004
Number of extensions: 79884
Number of successful extensions: 223
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 217
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 223
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 410448950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).