SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces...   156   2e-39
SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha 2|Schizosacchar...    97   3e-21
SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|ch...    96   4e-21
SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|...    77   3e-15
SPAC8F11.09c |nnt1||nicotinamide N-methyltransferase Nnt1 |Schiz...    28   1.0  
SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc...    28   1.3  
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    27   2.3  
SPAC29E6.01 |pof11|SPAC30.05, mug156|F-box protein Pof11|Schizos...    27   3.1  
SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual        26   4.1  
SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 s...    26   4.1  
SPAC27D7.10c |||But2 family protein|Schizosaccharomyces pombe|ch...    26   5.4  
SPAC27D7.09c |||But2 family protein|Schizosaccharomyces pombe|ch...    26   5.4  
SPBC2G2.01c |liz1|SPBC4B4.13c|pantothenate transporter |Schizosa...    25   7.1  
SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomy...    25   7.1  
SPAC24C9.14 |otu1|mug141|ubiquitin-specific protease |Schizosacc...    25   7.1  
SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Sc...    25   9.4  

>SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score =  156 bits (379), Expect = 2e-39
 Identities = 67/88 (76%), Positives = 79/88 (89%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           R+NVY+NEA+GGKYVPRAV+VDLEPGTMD+V+SG FG +FRPDN ++GQSGAGN WAKGH
Sbjct: 46  RLNVYFNEAAGGKYVPRAVLVDLEPGTMDAVKSGKFGNLFRPDNIIYGQSGAGNIWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL D+VLDVVR+EAE CD  + F
Sbjct: 106 YTEGAELADAVLDVVRREAEACDALQGF 133



 Score = 74.5 bits (175), Expect = 1e-14
 Identities = 30/43 (69%), Positives = 35/43 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQ 251
           MREIVHIQAGQCGNQ+GA FW  I+DEHG+D+ G Y G S+ Q
Sbjct: 1   MREIVHIQAGQCGNQVGAAFWSTIADEHGLDSAGIYHGTSEAQ 43



 Score = 39.1 bits (87), Expect = 5e-04
 Identities = 20/44 (45%), Positives = 22/44 (50%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDR+M TFSV P+ K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRMMATFSVAPAPK 174


>SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha
           2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 449

 Score = 96.7 bits (230), Expect = 3e-21
 Identities = 38/80 (47%), Positives = 56/80 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + +++E   GKYVPR++ VDLEP  +D VR+GP+  +F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGQGKYVPRSIYVDLEPNVIDQVRTGPYRDLFHPEQLITGKEDASNNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G ELVD V D +R+ A+ C
Sbjct: 110 VGKELVDEVTDKIRRIADNC 129



 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 18/34 (52%), Positives = 20/34 (58%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           MREI+ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREIISIHVGQAGTQIGNACWELYCLEHGIQPNG 34


>SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 455

 Score = 95.9 bits (228), Expect = 4e-21
 Identities = 37/78 (47%), Positives = 57/78 (73%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           +++E   GK+VPR++ VDLEP  +D VR+GP+  +F P+  V G+  A NN+A+GHYT G
Sbjct: 56  FFSETGQGKFVPRSIYVDLEPNVIDQVRTGPYKDLFHPEQMVTGKEDASNNYARGHYTVG 115

Query: 449 AELVDSVLDVVRKEAEGC 502
            E++DSVL+ +R+ A+ C
Sbjct: 116 KEMIDSVLERIRRMADNC 133



 Score = 41.1 bits (92), Expect = 1e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNAS 263
           MRE++ +  GQ G QIG   WE+   EHGI   G  + +S++  N S
Sbjct: 1   MREVISVHVGQAGVQIGNACWELYCLEHGIGPDGFPTENSEVHKNNS 47


>SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 446

 Score = 76.6 bits (180), Expect = 3e-15
 Identities = 30/91 (32%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS--GAGNNWAK 430
           R +V++ ++   +Y+PRA+++DLEP  ++++ S  +G ++ P+N +  ++  GAGNNWA 
Sbjct: 47  RKDVFFYQSDDTRYIPRAILIDLEPRVVNNILSDTYGSLYNPENILITKNGGGAGNNWAN 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVFS 523
           G Y+    + + ++D++ +EA+G D    FS
Sbjct: 107 G-YSHAERIFEDIMDMIDREADGSDSLEGFS 136



 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 20/33 (60%), Positives = 26/33 (78%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +QAGQCGNQIG++FW+ +  EHGI   G
Sbjct: 3   REIITLQAGQCGNQIGSQFWQQLCLEHGIGPDG 35



 Score = 25.8 bits (54), Expect = 5.4
 Identities = 8/21 (38%), Positives = 16/21 (76%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           ++ + YP +I+ T+SV P+S+
Sbjct: 156 RLNDRYPKKIIQTYSVFPNSQ 176


>SPAC8F11.09c |nnt1||nicotinamide N-methyltransferase Nnt1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 255

 Score = 28.3 bits (60), Expect = 1.0
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -1

Query: 414 PAPDCPKTKLSGRKICPNGPERTESMVPGSRS 319
           P+   PK  L  R I PNGPE  +  + GS S
Sbjct: 20  PSTPPPKEVLHTRVIVPNGPEEIKLRLVGSHS 51


>SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit
           Apc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1458

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = -2

Query: 287 LKLRYSRH*CVKLQVGVAAVSTRGVNAVLVRDYFPELCSDLIPALTRLDVDDFPHDCT 114
           ++L  SR  C +   G+  +    V  +   +Y P   S+ +  + RLDVD F H  T
Sbjct: 599 VRLGISRKRCERYPFGILCIIFT-VLEIAAEEYSPNWESEELRLVNRLDVDSFLHPKT 655


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 15/62 (24%), Positives = 27/62 (43%)
 Frame = -3

Query: 529 ELAENPATIAAFCFFSNYIQYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDLPKRPGT 350
           +L   P   AA+  +S++     + FSP   +   P +  P   ++ V     LP+ P +
Sbjct: 103 QLPNEPQNSAAYTTYSSFPNALFDDFSPNNPLDTDPFLTSPGNKQNTVDSFRPLPETPVS 162

Query: 349 DG 344
            G
Sbjct: 163 PG 164


>SPAC29E6.01 |pof11|SPAC30.05, mug156|F-box protein
           Pof11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 506

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = +2

Query: 356 GPFGQIFRPDNFVFGQSGAG-NNWAKGHYTEGAEL 457
           GP+G +F P  F+F  +G    NW+   Y E A L
Sbjct: 157 GPYGTMFLPQQFIFDSNGRPLLNWSY-LYKEHAHL 190


>SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 234

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +2

Query: 425 AKGHYTEGAELVDSVLDVVRKEAEGCDCCRVFS*LILWEEVLD 553
           A+GH   G ELV +  D +RK++E      V    I+  E L+
Sbjct: 183 AEGHPDVGVELVRAGADTLRKDSENHTALEVCPDRIVCNEFLE 225


>SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3
           subunit Alp6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 821

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 10/35 (28%), Positives = 18/35 (51%)
 Frame = -2

Query: 191 YFPELCSDLIPALTRLDVDDFPHDCTKNLEPPESN 87
           +F E+   + P   +LD+DD  +     + P E+N
Sbjct: 36  FFQEIIHSISPDTFQLDIDDILYKIYSKIPPEENN 70


>SPAC27D7.10c |||But2 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 383

 Score = 25.8 bits (54), Expect = 5.4
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +1

Query: 88  FDSGGSKFLVQS*GKSSTSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPT 246
           F S  S     S   +STS RV++  ++  SSG  + T+  +   V  +AT T
Sbjct: 165 FVSPSSSSSSSSSAATSTSTRVSSSAKASTSSGAIAYTTKCVVVPVTASATAT 217


>SPAC27D7.09c |||But2 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 383

 Score = 25.8 bits (54), Expect = 5.4
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +1

Query: 88  FDSGGSKFLVQS*GKSSTSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPT 246
           F S  S     S   +STS RV++  ++  SSG  + T+  +   V  +AT T
Sbjct: 165 FVSPSSSSSSSSSAATSTSTRVSSSAKASTSSGAIAYTTKCVVVPVTASATAT 217


>SPBC2G2.01c |liz1|SPBC4B4.13c|pantothenate transporter
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 514

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
 Frame = +2

Query: 533 LWEEVLDLVWGLF-*FPKSVKSIQIVL*IRF 622
           LW  V++++WGL   F  +V S++ ++ +RF
Sbjct: 98  LWFSVMNILWGLMTIFSFAVHSVRALMILRF 128


>SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 543

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 7/21 (33%), Positives = 14/21 (66%)
 Frame = -3

Query: 148 AWMWTISLMIALKIWNPPNRI 86
           AW+W ++LM+    +  PN++
Sbjct: 458 AWLWFMALMLLFPSYQNPNKV 478


>SPAC24C9.14 |otu1|mug141|ubiquitin-specific protease
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 329

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -2

Query: 464 NQPVQPPLCNVLSPSYSPPQT 402
           N+P +PP+ N  +    PPQT
Sbjct: 86  NEPAKPPIPNAATKPTFPPQT 106


>SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1573

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 17/56 (30%), Positives = 24/56 (42%)
 Frame = +3

Query: 102 FQIFSAIMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLNASMS 269
           F + S I      I    C  +    +W+V+    G+  TGA S  SD  L  S+S
Sbjct: 807 FSVLSLICPSRTLIIDKACVEKTWPYWWDVLHQSFGVKLTGATSVASD-PLKGSIS 861


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,802,092
Number of Sequences: 5004
Number of extensions: 58339
Number of successful extensions: 186
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 185
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 291768710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).