SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0034
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo...    29   0.52 
SPAC15E1.07c |moa1|mug159|meiotic cohesin complex associated pro...    29   0.68 
SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pom...    28   0.90 
SPBC26H8.11c |||conserved fungal protein|Schizosaccharomyces pom...    27   2.1  
SPBC23G7.08c |rga7||GTPase activating protein Rga7|Schizosacchar...    26   3.6  
SPBC19C7.06 |||proline-tRNA ligase |Schizosaccharomyces pombe|ch...    25   8.4  
SPAC227.03c |||mitochondrial NAD+ transporter|Schizosaccharomyce...    25   8.4  
SPBC12C2.07c |||spermidine synthase |Schizosaccharomyces pombe|c...    25   8.4  

>SPAC343.11c |msc1||multi-copy suppressor of Chk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1588

 Score = 29.1 bits (62), Expect = 0.52
 Identities = 21/57 (36%), Positives = 27/57 (47%)
 Frame = -2

Query: 195 TTSLSNLGWKNPISAAIAS*FLLLEMLMRYLTEVLCPCFFLSRSRQASPLNIYGESL 25
           T S S  G++  IS  + S   LL  L    T   C C F S +  +SP + Y ESL
Sbjct: 406 TRSTSGKGFETKISINLDSDIKLLNTLSPLETFFWC-CSFPSTASTSSPFSYYPESL 461


>SPAC15E1.07c |moa1|mug159|meiotic cohesin complex associated
           protein Moa1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 172

 Score = 28.7 bits (61), Expect = 0.68
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +2

Query: 89  HKTSVRYLINISNNRNQEAIAAEIGFFHPRFDKEVVIKSNAVF 217
           H    R + NI N + +++I  +  ++H +   E +IK+ A F
Sbjct: 120 HVPDERLVSNIKNTQTKDSITRDSAYYHRKTMTESIIKTLAAF 162


>SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 781

 Score = 28.3 bits (60), Expect = 0.90
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
 Frame = -3

Query: 422 NLACWVFALLCTSTVPSKSIT-FTNGVWAKKTNLV 321
           N  CW+F  +     P++S++ FT+G+ AK+ NL+
Sbjct: 215 NFVCWLFDNM-EKDAPTESVSNFTDGINAKQLNLM 248


>SPBC26H8.11c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 175

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 12/39 (30%), Positives = 21/39 (53%)
 Frame = -2

Query: 117 LMRYLTEVLCPCFFLSRSRQASPLNIYGESLLVGYVTVV 1
           L+R+     CP +F+ +S + S +  +  S L GY  +V
Sbjct: 39  LVRHNALTFCPYYFIEKSGKGSVVYFHPTSDLCGYKNIV 77


>SPBC23G7.08c |rga7||GTPase activating protein
           Rga7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 695

 Score = 26.2 bits (55), Expect = 3.6
 Identities = 14/60 (23%), Positives = 28/60 (46%)
 Frame = +2

Query: 14  YPTSSDSPYIFSGEACLDLDKKKQGHKTSVRYLINISNNRNQEAIAAEIGFFHPRFDKEV 193
           Y    ++ Y+   EA + +DK K   K +        +N+N      ++GFF P+ + ++
Sbjct: 150 YAKKQENAYL---EAVMQMDKSKSRFKGAETEYNRALDNKNTGDSQKKVGFFKPKSNAQL 206


>SPBC19C7.06 |||proline-tRNA ligase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 716

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)
 Frame = -3

Query: 422 NLACWVFALLCTSTVPSKSITFTNGVWAK--KTNLVGETSNNSLETRSAP 279
           N A W  AL  T  VPS ++T T  +  K  K+  V      +LET S P
Sbjct: 28  NGATWASALQSTKDVPSHALTKTIVLKPKTAKSQTVVPIILAALETTSTP 77


>SPAC227.03c |||mitochondrial NAD+ transporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 371

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -3

Query: 368 SITFTNGVWAKKTNLVGET 312
           S+T TN +W  KT LV ++
Sbjct: 147 SVTLTNPIWVVKTRLVTQS 165


>SPBC12C2.07c |||spermidine synthase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 298

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 22/70 (31%), Positives = 32/70 (45%)
 Frame = +2

Query: 2   TTVTYPTSSDSPYIFSGEACLDLDKKKQGHKTSVRYLINISNNRNQEAIAAEIGFFHPRF 181
           T  TYP+ S    + S +A +DL K  +  K S      +    N E  AA   F  P F
Sbjct: 232 TIPTYPSGSIGFVVASKDASIDLSKPLR--KWSPEEENKLCKYYNSEIHAA--SFVLPTF 287

Query: 182 DKEVVIKSNA 211
            ++VV K+ +
Sbjct: 288 ARDVVDKATS 297


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,512,793
Number of Sequences: 5004
Number of extensions: 51341
Number of successful extensions: 140
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 140
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).