SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0032
         (648 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces pombe...    27   2.3  
SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces ...    25   7.1  

>SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 329

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 15/37 (40%), Positives = 21/37 (56%)
 Frame = -1

Query: 582 ANXSVLVAFKESIDGSLQVKYGTCFPAFSSPVTVRXQ 472
           A+ +V++AFKES D S   K+  C P  S P  +  Q
Sbjct: 30  ASVAVIIAFKESQDFS-NPKWPQCIPITSVPYVLLIQ 65


>SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 886

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 11/31 (35%), Positives = 14/31 (45%)
 Frame = +2

Query: 353 KYGDRVXTMSLPRASAPPGATPQRDYRPVPR 445
           K  D     S PR S  PG +P +  R + R
Sbjct: 247 KLDDSTDNSSKPRTSLQPGESPMKSSRDISR 277


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,070,161
Number of Sequences: 5004
Number of extensions: 31780
Number of successful extensions: 101
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 76
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 291768710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).