SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0030
         (578 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom...    26   3.5  
SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch...    26   4.6  
SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual    25   6.1  

>SPAPB1A11.01 ||SPAPB24D3.11|membrane
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 495

 Score = 26.2 bits (55), Expect = 3.5
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = +2

Query: 23  PCNYVYKVFILNTILLFFRTLSCKY 97
           P  +  ++ I+NTI++ F T+ C Y
Sbjct: 30  PLTWPIRIRIINTIIISFMTMLCMY 54


>SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 684

 Score = 25.8 bits (54), Expect = 4.6
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = -3

Query: 327 IMFLYDYRRFIYVDKLSIFSCFYYD 253
           + F Y Y +F++V + S  S +YY+
Sbjct: 207 LFFRYQYSQFLFVYRESFLSDYYYN 231


>SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 545

 Score = 25.4 bits (53), Expect = 6.1
 Identities = 8/31 (25%), Positives = 17/31 (54%)
 Frame = +2

Query: 134 MXNPPNQSYWFVLREDQSNVILSTNNFVNQN 226
           M N P+  YW  L    S ++ ++ N+++ +
Sbjct: 121 MANDPSMKYWLKLTNQLSGLLCASLNYIDSS 151


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,927,991
Number of Sequences: 5004
Number of extensions: 33200
Number of successful extensions: 60
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 248115846
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).