SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pomb...    26   3.6  
SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su...    26   3.6  
SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo...    25   4.8  
SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe...    25   4.8  
SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S...    25   6.3  
SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch...    25   8.4  

>SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 323

 Score = 25.8 bits (54), Expect = 3.6
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -1

Query: 481 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 368
           S+ LTRK +NT R+    +  PV  ++ +   +S  PP
Sbjct: 228 SIMLTRKLENTTRSDQGYLASPVPFLNGNEPANSGLPP 265


>SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase
           Sum3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 636

 Score = 25.8 bits (54), Expect = 3.6
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = -3

Query: 335 ERSSTRALRPYSSEERRSGTETA*LQTPSQFSFGYGG 225
           ++ S  A      +E  S   ++  QTPS+FS  YGG
Sbjct: 37  DKPSAGAAPAVGDDESVSSRGSSRSQTPSEFSSNYGG 73


>SPAC343.11c |msc1||multi-copy suppressor of Chk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1588

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 12/52 (23%), Positives = 27/52 (51%)
 Frame = -3

Query: 446 SNSELQY*AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPYSSEE 291
           SN  L   ++ ++     +  ++ +++A  ++  + AE SST  + PY S +
Sbjct: 148 SNYPLDAISSQQKFHGNDKTLEKNSAKATINKSNSTAETSSTATVEPYDSND 199


>SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 396

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -1

Query: 481 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 368
           S+ LTRK +N VR+  +    PV  ++     D E PP
Sbjct: 301 SMMLTRKYENMVRSDMHYSAVPVPFLNGDEPRDYELPP 338


>SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase
            Tor2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2337

 Score = 25.0 bits (52), Expect = 6.3
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +2

Query: 290  APLTSMDVERALSFAPRTWHRGLQELWRLF 379
            A L S ++ RA       WH GL+E  RL+
Sbjct: 1811 ARLVSHELIRAAILWHEQWHEGLEEASRLY 1840


>SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit
           Rev3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1480

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +1

Query: 13  SSGTSSIPKFHSSLQDLKQPSLQEPR 90
           S  T+S  K H S   LK+ S  EPR
Sbjct: 255 SDETNSFSKLHQSQFGLKEESSHEPR 280


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,873,656
Number of Sequences: 5004
Number of extensions: 31031
Number of successful extensions: 120
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 120
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 196153982
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).