SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces ...    28   0.90 
SPAC644.06c |cdr1|nim1|GIN4 family protein kinase Cdr1|Schizosac...    27   2.7  

>SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 390

 Score = 28.3 bits (60), Expect = 0.90
 Identities = 15/40 (37%), Positives = 20/40 (50%)
 Frame = -1

Query: 274 CGTVREVV*SPPLPAAWVQRMALSCSRLHGNTSCLFVLSL 155
           CGT   V     +   W+  +AL+ SR +GNT  L  L L
Sbjct: 173 CGTQVFVGSGRSIDCQWMDSVALNLSRYYGNTEALSSLPL 212


>SPAC644.06c |cdr1|nim1|GIN4 family protein kinase
           Cdr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 593

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +2

Query: 470 PII*LDPFKTKATDCSCVVWK*SDSLSV 553
           P + +D       DC CV+WK S S  V
Sbjct: 275 PSLSIDEIDPLVVDCMCVLWKKSSSKKV 302


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,414,113
Number of Sequences: 5004
Number of extensions: 46782
Number of successful extensions: 128
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 128
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).