SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0026
         (399 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch...    28   0.46 
SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual        26   2.5  
SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual     25   3.3  
SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosacchar...    25   3.3  
SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ...    25   4.3  
SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar...    25   5.7  
SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p...    24   10.0 
SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ...    24   10.0 
SPBC1289.03c |spi1||Ran GTPase Spi1|Schizosaccharomyces pombe|ch...    24   10.0 
SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase Ogm2|Schizo...    24   10.0 
SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces p...    24   10.0 

>SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 845

 Score = 28.3 bits (60), Expect = 0.46
 Identities = 14/27 (51%), Positives = 16/27 (59%)
 Frame = -2

Query: 116 ILQHRRPRLPLMQLEAPCSFNFCSLRA 36
           I Q     LP + L +PCSF  CSLRA
Sbjct: 48  IAQKSNISLPFLTL-SPCSFTICSLRA 73


>SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 384

 Score = 25.8 bits (54), Expect = 2.5
 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = +1

Query: 118 WHW-GSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 225
           W W GSVD  SG         N  R  S   TS+LR+
Sbjct: 39  WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQ 75


>SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 653

 Score = 25.4 bits (53), Expect = 3.3
 Identities = 12/46 (26%), Positives = 26/46 (56%)
 Frame = -2

Query: 203 QRLCFLPLFPLS*NRAREPLMESTDPQCHILQHRRPRLPLMQLEAP 66
           +++ FL L PLS    ++  +  ++P+   +QH++  L  ++L  P
Sbjct: 135 RKMQFLSLEPLSLLLLKDSFINKSNPEYESMQHQQILLKKLKLHFP 180


>SPBC19F5.03 |||inositol polyphosphate phosphatase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 598

 Score = 25.4 bits (53), Expect = 3.3
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +3

Query: 300 TSPVLXIAPGSDLFCXIWN*NA 365
           T P+  + P  ++FC IW+ NA
Sbjct: 411 THPLRSVIPLDNIFCNIWSDNA 432


>SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 285

 Score = 25.0 bits (52), Expect = 4.3
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = -2

Query: 143 MESTDPQCHILQHRRPRLPLMQLEAPCSF 57
           M+S   Q ++L   RP LPL     P  F
Sbjct: 88  MDSLSHQIYLLHKNRPTLPLKPTNQPTRF 116


>SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 507

 Score = 24.6 bits (51), Expect = 5.7
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = +1

Query: 49  QKLKEHGASSCISGKRGRRCCNIWHWGS 132
           Q   E  A +C  G  G  C  +W+W +
Sbjct: 394 QSSAEAAALACSGGSDGVTCGYMWYWNN 421


>SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 676

 Score = 23.8 bits (49), Expect = 10.0
 Identities = 11/30 (36%), Positives = 15/30 (50%)
 Frame = -2

Query: 122 CHILQHRRPRLPLMQLEAPCSFNFCSLRAI 33
           CH L HR+  L  M+  + C    C L A+
Sbjct: 647 CHHLYHRQCLLQWMETRSICPVCRCHLPAV 676


>SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1888

 Score = 23.8 bits (49), Expect = 10.0
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = +3

Query: 9   NIVAFIPAYRSKRTKIK 59
           N V+ IP YR+ +TK+K
Sbjct: 406 NAVSTIPVYRTTKTKMK 422


>SPBC1289.03c |spi1||Ran GTPase Spi1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 216

 Score = 23.8 bits (49), Expect = 10.0
 Identities = 8/30 (26%), Positives = 13/30 (43%)
 Frame = +1

Query: 97  GRRCCNIWHWGSVDSISGSRARFQLSGNSG 186
           G  C N+W     + + G R  + + G  G
Sbjct: 56  GEICFNVWDTAGQEKLGGLRDGYYIQGQCG 85


>SPAPB1E7.09 |ogm2|oma2|protein O-mannosyltransferase
           Ogm2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 739

 Score = 23.8 bits (49), Expect = 10.0
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = -2

Query: 152 EPLMESTDPQCHILQHRRPRLPLMQL-EAPCSF 57
           +P   +TD Q ++ +H  PRLP   + + P SF
Sbjct: 506 DPDPSNTDTQWNVEEHINPRLPEGSINDYPSSF 538


>SPAC1039.02 |||phosphoprotein phosphatase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 601

 Score = 23.8 bits (49), Expect = 10.0
 Identities = 12/35 (34%), Positives = 15/35 (42%)
 Frame = +1

Query: 97  GRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSR 201
           G R C    W S+D +S S A  Q  G      +R
Sbjct: 287 GGRYCETVGWLSIDGLSASNATRQYVGRPVTNETR 321


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,416,442
Number of Sequences: 5004
Number of extensions: 23139
Number of successful extensions: 40
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 40
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 134126124
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).