SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC800.04c |rpl4301|rpl43-1, rpl43, rpl37a-1|60S ribosomal prot...   113   4e-27
SPBC83.02c |rpl4302|rpl43-2, rpl43, rpl37a-2|60S ribosomal prote...   112   1e-26
SPBC16E9.09c |||COPII vesicle coat component Erp5/Erp6|Schizosac...    29   0.10 
SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual        28   0.31 
SPAC1F7.11c |||transcription factor zf-fungal binuclear cluster ...    26   0.95 
SPBC29A3.05 |||chromatin remodeling complex subunit|Schizosaccha...    26   1.2  
SPAC2E12.02 |hsf1|hstf, hsf|transcription factor Hsf1|Schizosacc...    26   1.2  
SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ...    26   1.2  
SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 ...    25   1.7  
SPAC17D4.04 ||SPAC458.01|tRNA |Schizosaccharomyces pombe|chr 1||...    25   2.2  
SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce...    25   2.9  
SPBC29A10.14 |rec8||meiotic cohesin complex subunit Rec8|Schizos...    24   3.8  
SPAC24B11.06c |sty1|spc1, phh1|MAP kinase Sty1|Schizosaccharomyc...    24   3.8  
SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase Nak1|Schizosacch...    24   5.0  
SPBC2D10.03c |||DUF866 domain protein|Schizosaccharomyces pombe|...    23   6.7  
SPCC126.02c |pku70||Ku domain protein Pku70|Schizosaccharomyces ...    23   6.7  
SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|ch...    23   8.8  
SPBC1683.05 |||thiamine transporter |Schizosaccharomyces pombe|c...    23   8.8  
SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ...    23   8.8  
SPCC1393.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3||...    23   8.8  

>SPBC800.04c |rpl4301|rpl43-1, rpl43, rpl37a-1|60S ribosomal protein
           L37a|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 94

 Score =  113 bits (273), Expect = 4e-27
 Identities = 49/81 (60%), Positives = 62/81 (76%), Gaps = 2/81 (2%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSC--K 199
           M KRTKKVG+TGKYG RYGASLR+ V+K+EV QH++Y C FCG++ +KR+  GIW C  K
Sbjct: 1   MTKRTKKVGVTGKYGVRYGASLRRDVRKIEVQQHSRYQCPFCGRNTVKRTAAGIWCCNGK 60

Query: 200 RCKRTVAGGAWVFSTTAAYHA 262
            CK+ +AGGAW  +T AA  A
Sbjct: 61  GCKKVLAGGAWTVTTAAATSA 81


>SPBC83.02c |rpl4302|rpl43-2, rpl43, rpl37a-2|60S ribosomal protein
           L37a|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 94

 Score =  112 bits (269), Expect = 1e-26
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSC--K 199
           M KRTKKVG+TGKYG RYGASLR+ V+K+EV QH++Y C FCG+  +KR+  GIW C  K
Sbjct: 1   MTKRTKKVGVTGKYGVRYGASLRRDVRKIEVQQHSRYQCPFCGRLTVKRTAAGIWKCSGK 60

Query: 200 RCKRTVAGGAWVFSTTAAYHA 262
            C +T+AGGAW  +T AA  A
Sbjct: 61  GCSKTLAGGAWTVTTAAATSA 81


>SPBC16E9.09c |||COPII vesicle coat component
           Erp5/Erp6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 215

 Score = 29.5 bits (63), Expect = 0.10
 Identities = 17/71 (23%), Positives = 28/71 (39%)
 Frame = +2

Query: 62  KYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCKRTVAGGAWVFS 241
           K+ T     +R  V +     H  Y       +A++ +     + + C  + + GAW  S
Sbjct: 57  KWVTSNNIKIRVQVDETFANNHLIYKNDLRSNEAVRFTTTNEGTHRICYLSTSDGAWFSS 116

Query: 242 TTAAYHADLLS 274
           T    H DL S
Sbjct: 117 TKTRLHVDLAS 127


>SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 384

 Score = 27.9 bits (59), Expect = 0.31
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = -2

Query: 219 ATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTS 112
           +T +L ++  Q+ T   F+A + +NE  +FA W TS
Sbjct: 69  STSVLRQVGWQLSTS--FVAHVSENENTFFAIWYTS 102


>SPAC1F7.11c |||transcription factor zf-fungal binuclear cluster
           type |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 782

 Score = 26.2 bits (55), Expect = 0.95
 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%)
 Frame = +2

Query: 122 QHAKYT-CSFCGKDAMKRSCVGIWSCKRCKR 211
           +H K T C  C +  +K  C  +W C+ CK+
Sbjct: 15  RHRKITSCRECHR--LKLKCDRVWPCENCKK 43


>SPBC29A3.05 |||chromatin remodeling complex
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 139

 Score = 25.8 bits (54), Expect = 1.2
 Identities = 11/30 (36%), Positives = 13/30 (43%)
 Frame = +2

Query: 131 KYTCSFCGKDAMKRSCVGIWSCKRCKRTVA 220
           KY C  CG     + C  I S  RC +  A
Sbjct: 110 KYACQNCGTSYCSKGCEVIHSETRCMKVYA 139


>SPAC2E12.02 |hsf1|hstf, hsf|transcription factor
           Hsf1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 609

 Score = 25.8 bits (54), Expect = 1.2
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = -1

Query: 109 LFDHFT*RGTVTCAIFASNSNLFGT 35
           +FD FT    +T  I ASN N FG+
Sbjct: 550 VFDEFTNISNLTSPIEASNGNTFGS 574


>SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1364

 Score = 25.8 bits (54), Expect = 1.2
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -3

Query: 74   VCHICQ*FQPFWYVWPF 24
            + ++ Q FQ  WY WPF
Sbjct: 1251 IVYLVQDFQRLWYHWPF 1267


>SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 315

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +1

Query: 157 GCYETFLCRHLVL*AMQEDCSRRSLGILH 243
           G  + +LC+ L +    E C   S+G+LH
Sbjct: 234 GSKDRYLCKDLTVVMTHEPCVMCSMGLLH 262


>SPAC17D4.04 ||SPAC458.01|tRNA |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 654

 Score = 25.0 bits (52), Expect = 2.2
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = -2

Query: 213 VLLHRLQDQMPTQERFIASLPQNEQV 136
           +L  +L +Q+PT  R  AS+P   QV
Sbjct: 32  LLKQKLTEQLPTTFRITASIPHATQV 57


>SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 351

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -2

Query: 111 IFLTILRREAP*RVPYLPVIPTFLVRLAILVNL 13
           I L I   + P    Y+P++P  L RL  L N+
Sbjct: 253 IMLEICSSQLPFVEQYMPILPLLLERLKSLQNM 285


>SPBC29A10.14 |rec8||meiotic cohesin complex subunit
           Rec8|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 561

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 6   YRRGLPKWPNVPKRLELL 59
           YR+ LP  P++P R+E L
Sbjct: 427 YRKRLPHSPSMPSRVEFL 444


>SPAC24B11.06c |sty1|spc1, phh1|MAP kinase Sty1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 349

 Score = 24.2 bits (50), Expect = 3.8
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = -2

Query: 171 RFIASLPQNEQVYFA 127
           RF+ SLPQ E+V FA
Sbjct: 248 RFVQSLPQKEKVPFA 262


>SPBC17F3.02 |nak1|orb3, mor4|PAK-related kinase
           Nak1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 652

 Score = 23.8 bits (49), Expect = 5.0
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +1

Query: 13  EVYQNGQTYQKGWNYWQIWHTLRCLST*NGQKDGSNPTRKVYLL 144
           EV ++GQ Y    + W +  T   ++T +      +P R VYL+
Sbjct: 178 EVIRDGQEYNVMADIWSLGITAYEIATGSPPHAKEDPFRAVYLI 221


>SPBC2D10.03c |||DUF866 domain protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 157

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = +2

Query: 185 IWSCKRCKRT 214
           IW+CK C++T
Sbjct: 65  IWTCKNCRKT 74


>SPCC126.02c |pku70||Ku domain protein Pku70|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 607

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 9/16 (56%), Positives = 13/16 (81%)
 Frame = -2

Query: 174 ERFIASLPQNEQVYFA 127
           ERF  ++PQ++QV FA
Sbjct: 273 ERFAVAVPQSKQVSFA 288


>SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 783

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +1

Query: 25  NGQTYQKGWNYWQIW 69
           NG T Q G+  WQ W
Sbjct: 656 NGNTSQSGFMAWQRW 670


>SPBC1683.05 |||thiamine transporter |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 559

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = -2

Query: 135 YFACWVTSIFLTILRREAP*RVPYLPVIPTFLVRLAILVNL 13
           YF  WV S    ++R E   R   +  I T++   A+L+ L
Sbjct: 202 YFVYWVISFPFHLIRPEYLQRFFLIKSISTYIACFAMLIFL 242


>SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 791

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 64  FASNSNLFGTFGHFGKPL 11
           FA+N  LFG   HF + L
Sbjct: 149 FATNEKLFGVKSHFDEDL 166


>SPCC1393.05 |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 956

 Score = 23.0 bits (47), Expect = 8.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -2

Query: 183 PTQERFIASLPQNEQVYFACWVTSIFLTI 97
           P Q +F+    +NE +Y A   TSIF ++
Sbjct: 253 PCQLKFLKLKFENEILYTAMHTTSIFKSV 281


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,329,649
Number of Sequences: 5004
Number of extensions: 26460
Number of successful extensions: 76
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 74
length of database: 2,362,478
effective HSP length: 62
effective length of database: 2,052,230
effective search space used: 67723590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).