SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0020
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9...    27   2.7  
SPBC15D4.01c ||SPBC2D10.21c|kinesin-like protein|Schizosaccharom...    25   6.3  

>SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit
           Srb9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1223

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = +3

Query: 360 SFALGMFKQSIYNQTMLLFTKSSD*ITKMVVMFYYNVKTALTECK 494
           S  L  + +S   +  LL +KS D ++   + F+Y+V+ A   CK
Sbjct: 765 SLCLQPYGESKDFEVFLLSSKSPD-VSSKAISFFYDVQLAYENCK 808


>SPBC15D4.01c ||SPBC2D10.21c|kinesin-like
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 633

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 15/37 (40%), Positives = 22/37 (59%)
 Frame = +1

Query: 241 SLLTIYNSME*HSQLNKYRRKRHIIMLRKINMTILLF 351
           SLLT+   +E  +   K+  K+HII  R+  +T LLF
Sbjct: 319 SLLTLGQCLE--ALRRKHEGKQHIIPFRQSKLTELLF 353


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,165,047
Number of Sequences: 5004
Number of extensions: 38687
Number of successful extensions: 66
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 66
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 66
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).