SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0018
         (678 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC947.08c |||histone promoter control protein Hpc2 |Schizosacc...    27   3.3  
SPBC21.06c |cdc7|pld1, its10|serine/threonine protein kinase Cdc...    27   3.3  
SPAPYUG7.03c |mid2||anillin homologue Mid2|Schizosaccharomyces p...    26   4.4  
SPBPB10D8.01 |||cysteine transporter |Schizosaccharomyces pombe|...    26   4.4  
SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|...    26   5.8  
SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo...    26   5.8  
SPAC56F8.03 |||translation initiation factor IF2 |Schizosaccharo...    25   7.6  
SPBC16A3.17c |||membrane transporter|Schizosaccharomyces pombe|c...    25   7.6  
SPCC162.06c |||vacuolar sorting protein Vps60|Schizosaccharomyce...    25   7.6  

>SPBC947.08c |||histone promoter control protein Hpc2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 338

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = +2

Query: 245 TFQASASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRK 424
           + + +A    +E KR++  VPK     +    KSK K+ +  +        SVP +   +
Sbjct: 185 SIEMAAKNALKEAKRENAKVPKDVSKKEAKTTKSKEKATKKTS-------SSVPKQSTGE 237

Query: 425 RSPRTRKVETP-RKTPTLRSHKGLENKHS 508
            + +  K+ETP   TP +      E KHS
Sbjct: 238 NTKKAVKLETPLTSTPPIPPLS--EPKHS 264


>SPBC21.06c |cdc7|pld1, its10|serine/threonine protein kinase
           Cdc7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1062

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +1

Query: 358 LTKSEHYRSSVSNFRSSKNN*KTFASDS*SRN 453
           L KSEH+    SNF+   N+    +S S SR+
Sbjct: 344 LKKSEHFMDFCSNFKGKNNSSSITSSPSKSRH 375


>SPAPYUG7.03c |mid2||anillin homologue Mid2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 704

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 11/38 (28%), Positives = 20/38 (52%)
 Frame = +2

Query: 335 PIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKV 448
           P+ S   SL + ++++   PI + PK++    PR   V
Sbjct: 290 PLTSSITSLDSPHVLDENAPIPLLPKVVSLPDPRFTNV 327


>SPBPB10D8.01 |||cysteine transporter |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 552

 Score = 26.2 bits (55), Expect = 4.4
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = +1

Query: 271 VRRNKKRFMLCSQEKEKH 324
           VRRNKKR  L  Q KE++
Sbjct: 497 VRRNKKRLALLEQNKEQY 514


>SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 743

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 10/16 (62%), Positives = 14/16 (87%)
 Frame = +1

Query: 274 RRNKKRFMLCSQEKEK 321
           ++NKKR +L SQEKE+
Sbjct: 463 QQNKKRLLLVSQEKER 478


>SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit
           Bgs3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1826

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -2

Query: 338 LAMAVCFSFSWEQSMNLFLFLRTVLMQTLERYPP 237
           + +A+ F F W+   N+F +L  +L     R  P
Sbjct: 167 IELAMKFGFQWDNMRNMFDYLMVMLDSRASRMTP 200


>SPAC56F8.03 |||translation initiation factor IF2
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1079

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = +2

Query: 347 KAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRK 463
           K K  QN N  EAA P  +P   ++ +  + R+ +   K
Sbjct: 154 KGKKAQNNNESEAAAPPEIPEVRVKTKKEKEREKKEREK 192


>SPBC16A3.17c |||membrane transporter|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 599

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = -1

Query: 366 FCKLLAFDLIGNGCMFFFLLGT 301
           FC +L   ++   C+FFF+LG+
Sbjct: 154 FCNILGRKIVLYICIFFFMLGS 175


>SPCC162.06c |||vacuolar sorting protein Vps60|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 210

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 11/40 (27%), Positives = 24/40 (60%)
 Frame = +3

Query: 114 KKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLD 233
           +K++KLQD++ D+    G+L  ++ + +   +   E +LD
Sbjct: 126 EKIEKLQDEIQDYMDAAGELNEVLGQ-NMTDINVDEEELD 164


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,505,540
Number of Sequences: 5004
Number of extensions: 48348
Number of successful extensions: 167
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 167
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 311890690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).