SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0017
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB1E7.02c |mcl1|slr3|DNA polymerase alpha accessory factor Mc...    29   0.64 
SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch...    27   2.6  
SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyce...    27   3.4  
SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,...    26   4.5  
SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom...    26   4.5  

>SPAPB1E7.02c |mcl1|slr3|DNA polymerase alpha accessory factor
           Mcl1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 815

 Score = 29.1 bits (62), Expect = 0.64
 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = +1

Query: 214 C*SKSPNSTSRDKIVVETG-ENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKI 390
           C + +P++++   ++ E    N+ F+ + E  I   + D    EK+     +   D++ +
Sbjct: 704 CNTNNPDASTSVPVLEELQLRNKLFLTLLEDSI--GDGDVTEDEKISIARLEANIDKALL 761

Query: 391 RLLLKLCLEDRFKNINK-QKTL 453
           +L+ K CLE+R + + +  KTL
Sbjct: 762 QLIQKACLEERIERVYELTKTL 783


>SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 684

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = -3

Query: 333 LAIMFLYDYRRFIYVDKLSIFSCFYYD 253
           L + F Y Y +F++V + S  S +YY+
Sbjct: 205 LKLFFRYQYSQFLFVYRESFLSDYYYN 231


>SPBC215.12 |cwf10|spef2, snu114|GTPase Cwf10 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 983

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 1/89 (1%)
 Frame = +1

Query: 214 C*SKSPNSTSRDKIVVETGENRQFIHINEPPIIVQEHDSQPQEKVCST-TKDVFWDRSKI 390
           C S +PN  +R  +VVE  E      I    + +    + PQ+++     K+  WD    
Sbjct: 687 CFSDTPNKKNRITMVVEPLEKGISNDIENGKVNI----NWPQKRISEFFQKNYDWDLLAS 742

Query: 391 RLLLKLCLEDRFKNINKQKTLWHDIASHV 477
           R +     +DR  NI +  TL  D+  +V
Sbjct: 743 RSIWAFGPDDRGTNILRDDTLSTDVDKNV 771


>SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2
           alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 546

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = -3

Query: 390 YFASIPKDVFSSTTNFFLWLAIMFLYDYRRFIYVDKLSIF 271
           YF  +P    + TT  FL ++ +++   R  IYV    IF
Sbjct: 254 YFVRLPWLFLNPTTLLFLLISFVYIKPARLLIYVPLFFIF 293


>SPAPB1A11.01 ||SPAPB24D3.11|membrane
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 495

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = +2

Query: 23  PCNYVYKVFILNTILLFFRTLSCKY 97
           P  +  ++ I+NTI++ F T+ C Y
Sbjct: 30  PLTWPIRIRIINTIIISFMTMLCMY 54


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,866,759
Number of Sequences: 5004
Number of extensions: 59826
Number of successful extensions: 149
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 144
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 149
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).