SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces...   156   2e-39
SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha 2|Schizosacchar...    99   6e-22
SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|ch...    98   1e-21
SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|...    78   1e-15
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    29   0.52 
SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual        28   0.90 
SPAC8F11.09c |nnt1||nicotinamide N-methyltransferase Nnt1 |Schiz...    28   0.90 
SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc...    27   1.6  
SPAC29E6.01 |pof11|SPAC30.05, mug156|F-box protein Pof11|Schizos...    27   2.7  
SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3 s...    26   3.6  
SPAC27D7.10c |||But2 family protein|Schizosaccharomyces pombe|ch...    26   4.8  
SPAC27D7.09c |||But2 family protein|Schizosaccharomyces pombe|ch...    26   4.8  
SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1 |Sc...    25   6.3  
SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomy...    25   6.3  
SPAC24C9.14 |otu1|mug141|ubiquitin-specific protease |Schizosacc...    25   8.4  

>SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score =  156 bits (379), Expect = 2e-39
 Identities = 67/87 (77%), Positives = 79/87 (90%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           +NVY+NEA+GGKYVPRAV+VDLEPGTMD+V+SG FG +FRPDN ++GQSGAGN WAKGHY
Sbjct: 47  LNVYFNEAAGGKYVPRAVLVDLEPGTMDAVKSGKFGNLFRPDNIIYGQSGAGNIWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL D+VLDVVR+EAE CD L+ F
Sbjct: 107 TEGAELADAVLDVVRREAEACDALQGF 133



 Score = 75.4 bits (177), Expect = 6e-15
 Identities = 31/45 (68%), Positives = 36/45 (80%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQ+GA FW  I+DEHG+D+ G Y G S+ Q E
Sbjct: 1   MREIVHIQAGQCGNQVGAAFWSTIADEHGLDSAGIYHGTSEAQHE 45


>SPBC800.05c |tub1|atb2, alp2, ban5|tubulin alpha
           2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 449

 Score = 98.7 bits (235), Expect = 6e-22
 Identities = 40/86 (46%), Positives = 59/86 (68%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 439
           + +++E   GKYVPR++ VDLEP  +D VR+GP+  +F P+  + G+  A NN+A+GHYT
Sbjct: 50  STFFSETGQGKYVPRSIYVDLEPNVIDQVRTGPYRDLFHPEQLITGKEDASNNYARGHYT 109

Query: 440 EGAELVDSVLDVVRKEAEGCDCLRVF 517
            G ELVD V D +R+ A+ C  L+ F
Sbjct: 110 VGKELVDEVTDKIRRIADNCSGLQGF 135



 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 18/34 (52%), Positives = 20/34 (58%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           MREI+ I  GQ G QIG   WE+   EHGI   G
Sbjct: 1   MREIISIHVGQAGTQIGNACWELYCLEHGIQPNG 34


>SPBC16A3.15c |nda2||tubulin alpha 1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 455

 Score = 97.9 bits (233), Expect = 1e-21
 Identities = 39/84 (46%), Positives = 60/84 (71%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 445
           +++E   GK+VPR++ VDLEP  +D VR+GP+  +F P+  V G+  A NN+A+GHYT G
Sbjct: 56  FFSETGQGKFVPRSIYVDLEPNVIDQVRTGPYKDLFHPEQMVTGKEDASNNYARGHYTVG 115

Query: 446 AELVDSVLDVVRKEAEGCDCLRVF 517
            E++DSVL+ +R+ A+ C  L+ F
Sbjct: 116 KEMIDSVLERIRRMADNCSGLQGF 139



 Score = 38.7 bits (86), Expect = 6e-04
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE++ +  GQ G QIG   WE+   EHGI   G  + +S++
Sbjct: 1   MREVISVHVGQAGVQIGNACWELYCLEHGIGPDGFPTENSEV 42


>SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 446

 Score = 77.8 bits (183), Expect = 1e-15
 Identities = 30/89 (33%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQS--GAGNNWAKGH 433
           +V++ ++   +Y+PRA+++DLEP  ++++ S  +G ++ P+N +  ++  GAGNNWA G 
Sbjct: 49  DVFFYQSDDTRYIPRAILIDLEPRVVNNILSDTYGSLYNPENILITKNGGGAGNNWANG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVFS 520
           Y+    + + ++D++ +EA+G D L  FS
Sbjct: 108 YSHAERIFEDIMDMIDREADGSDSLEGFS 136



 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 20/33 (60%), Positives = 26/33 (78%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +QAGQCGNQIG++FW+ +  EHGI   G
Sbjct: 3   REIITLQAGQCGNQIGSQFWQQLCLEHGIGPDG 35


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 29.1 bits (62), Expect = 0.52
 Identities = 16/62 (25%), Positives = 28/62 (45%)
 Frame = -1

Query: 526 ELAENPQTIAAFCFFSNYIQYRINQFSPLCVMXFRPVIPRPRLSEDEVVRSEDLPKRPGT 347
           +L   PQ  AA+  +S++     + FSP   +   P +  P   ++ V     LP+ P +
Sbjct: 103 QLPNEPQNSAAYTTYSSFPNALFDDFSPNNPLDTDPFLTSPGNKQNTVDSFRPLPETPVS 162

Query: 346 DG 341
            G
Sbjct: 163 PG 164


>SPAC6C3.08 |||gankyrin|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 234

 Score = 28.3 bits (60), Expect = 0.90
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = +2

Query: 422 AKGHYTEGAELVDSVLDVVRKEAEGCDCLRVFS*LILWEEVLD 550
           A+GH   G ELV +  D +RK++E    L V    I+  E L+
Sbjct: 183 AEGHPDVGVELVRAGADTLRKDSENHTALEVCPDRIVCNEFLE 225


>SPAC8F11.09c |nnt1||nicotinamide N-methyltransferase Nnt1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 255

 Score = 28.3 bits (60), Expect = 0.90
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -2

Query: 411 PAPDCPKTKLSGRKICPNGPERTESMVPGSRS 316
           P+   PK  L  R I PNGPE  +  + GS S
Sbjct: 20  PSTPPPKEVLHTRVIVPNGPEEIKLRLVGSHS 51


>SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit
           Apc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1458

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = -3

Query: 284 LKLRYSRH*CFKLQVGVAAVSTRGVNAVLVRDYFPELCSDLIPALTRLDVDDFPHDCT 111
           ++L  SR  C +   G+  +    V  +   +Y P   S+ +  + RLDVD F H  T
Sbjct: 599 VRLGISRKRCERYPFGILCIIFT-VLEIAAEEYSPNWESEELRLVNRLDVDSFLHPKT 655


>SPAC29E6.01 |pof11|SPAC30.05, mug156|F-box protein
           Pof11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 506

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = +2

Query: 353 GPFGQIFRPDNFVFGQSGAG-NNWAKGHYTEGAEL 454
           GP+G +F P  F+F  +G    NW+   Y E A L
Sbjct: 157 GPYGTMFLPQQFIFDSNGRPLLNWSY-LYKEHAHL 190


>SPBC428.20c |alp6|SPBC902.01c|gamma tubulin complex Spc98/GCP3
           subunit Alp6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 821

 Score = 26.2 bits (55), Expect = 3.6
 Identities = 10/35 (28%), Positives = 18/35 (51%)
 Frame = -3

Query: 188 YFPELCSDLIPALTRLDVDDFPHDCTKNLEPPESN 84
           +F E+   + P   +LD+DD  +     + P E+N
Sbjct: 36  FFQEIIHSISPDTFQLDIDDILYKIYSKIPPEENN 70


>SPAC27D7.10c |||But2 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 383

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +1

Query: 85  FDSGGSKFLVQS*GKSSTSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPT 243
           F S  S     S   +STS RV++  ++  SSG  + T+  +   V  +AT T
Sbjct: 165 FVSPSSSSSSSSSAATSTSTRVSSSAKASTSSGAIAYTTKCVVVPVTASATAT 217


>SPAC27D7.09c |||But2 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 383

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +1

Query: 85  FDSGGSKFLVQS*GKSSTSRRVNAGIRSEQSSGK*SRTSTALTPRVLTAATPT 243
           F S  S     S   +STS RV++  ++  SSG  + T+  +   V  +AT T
Sbjct: 165 FVSPSSSSSSSSSAATSTSTRVSSSAKASTSSGAIAYTTKCVVVPVTASATAT 217


>SPAC1834.02 |aro1||pentafunctional aromatic polypeptide Aro1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1573

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 17/56 (30%), Positives = 25/56 (44%)
 Frame = +3

Query: 99  FQIFSAIMREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLEASMS 266
           F + S I      I    C  +    +W+V+    G+  TGA S  SD  L+ S+S
Sbjct: 807 FSVLSLICPSRTLIIDKACVEKTWPYWWDVLHQSFGVKLTGATSVASD-PLKGSIS 861


>SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 543

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 7/21 (33%), Positives = 14/21 (66%)
 Frame = -1

Query: 145 AWMWTISLMIALKIWNPPNRI 83
           AW+W ++LM+    +  PN++
Sbjct: 458 AWLWFMALMLLFPSYQNPNKV 478


>SPAC24C9.14 |otu1|mug141|ubiquitin-specific protease
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 329

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -3

Query: 461 NQPVQPPLCNXLSPSYSPPQT 399
           N+P +PP+ N  +    PPQT
Sbjct: 86  NEPAKPPIPNAATKPTFPPQT 106


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,525,532
Number of Sequences: 5004
Number of extensions: 52434
Number of successful extensions: 172
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 160
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 171
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).