SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0013
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC2F12.04 |rpl1701|rpl17, rpl17-1|60S ribosomal protein L17|Sc...    34   0.017
SPCC364.03 |rpl1702|rpl17-2, rpl17|60S ribosomal protein L17|Sch...    34   0.022
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    29   0.64 
SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pomb...    26   6.0  
SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo...    26   6.0  
SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe...    25   7.9  

>SPBC2F12.04 |rpl1701|rpl17, rpl17-1|60S ribosomal protein
           L17|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 187

 Score = 34.3 bits (75), Expect = 0.017
 Identities = 16/30 (53%), Positives = 18/30 (60%)
 Frame = +2

Query: 518 KSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           K  KARG+ LR HFKN  E A  I  M L+
Sbjct: 13  KCAKARGAYLRTHFKNSREVAFTINGMSLK 42



 Score = 26.6 bits (56), Expect = 3.4
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +1

Query: 616 FRYLKNVIDKKECIPFRRF 672
           F +L NV + K+ +PFRRF
Sbjct: 45  FIFLDNVKEHKQAVPFRRF 63


>SPCC364.03 |rpl1702|rpl17-2, rpl17|60S ribosomal protein
           L17|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 187

 Score = 33.9 bits (74), Expect = 0.022
 Identities = 16/30 (53%), Positives = 18/30 (60%)
 Frame = +2

Query: 518 KSCKARGSNLRVHFKNXYETAMAIRKMPLR 607
           K  KARG+ LR HFKN  E A  I  M L+
Sbjct: 13  KCAKARGAYLRTHFKNSREVAFTINGMNLK 42



 Score = 26.6 bits (56), Expect = 3.4
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +1

Query: 616 FRYLKNVIDKKECIPFRRF 672
           F +L NV + K+ +PFRRF
Sbjct: 45  FIFLDNVKEHKQAVPFRRF 63


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1517

 Score = 29.1 bits (62), Expect = 0.64
 Identities = 20/39 (51%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
 Frame = +3

Query: 264  FEVT-LSPFPSDAPLTSMDVERALSFAPRRGTAVFKSSG 377
            FEV  LS FPSD   T   +ER+     R GTAVF+S+G
Sbjct: 1371 FEVNGLSHFPSDIEDT---IERSHPRIARGGTAVFQSAG 1406


>SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 323

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -2

Query: 487 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 374
           S+ LTRK +NT R+    +  PV  ++ +   +S  PP
Sbjct: 228 SIMLTRKLENTTRSDQGYLASPVPFLNGNEPANSGLPP 265


>SPAC343.11c |msc1||multi-copy suppressor of Chk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1588

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = -3

Query: 432 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEE 298
           +S Q     N +T   NS +++       AE SST  + PY S +
Sbjct: 155 ISSQQKFHGNDKTLEKNSAKATINKSNSTAETSSTATVEPYDSND 199


>SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 396

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -2

Query: 487 SVYLTRKTKNTVRTASYNIKRPVADISQHPNHDSEQPP 374
           S+ LTRK +N VR+  +    PV  ++     D E PP
Sbjct: 301 SMMLTRKYENMVRSDMHYSAVPVPFLNGDEPRDYELPP 338


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,765,916
Number of Sequences: 5004
Number of extensions: 51458
Number of successful extensions: 184
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 177
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 184
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).