SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0011
         (548 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe...    50   3e-07

>SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces
           pombe|chr mitochondrial|||Manual
          Length = 537

 Score = 49.6 bits (113), Expect = 3e-07
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = -1

Query: 254 QHFLGLAGIPRRYSDXPDSYIS*NIISSLGSYISRLSVXXXXXXX*ESIXNXRI 93
           QHFLGL G+PRR  D P++++  N +SS+GS IS LS+        +   + R+
Sbjct: 434 QHFLGLNGMPRRIPDYPEAFVGWNFVSSIGSVISILSLFLFMYVMYDQFTSNRV 487



 Score = 41.9 bits (94), Expect = 6e-05
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
 Frame = -2

Query: 514 IRFVFLFXVGGLTGVILANS--XIGYYXT*YLXXXXXXXXXXXXXXXXCNYWGIYXADXL 341
           I F+ LF +GGLTGVIL+NS   I ++ T ++                C  +  Y +  +
Sbjct: 349 IGFLILFTIGGLTGVILSNSVLDIAFHDTYFVVAHFHYVLSMGALFGLCGAY--YWSPKM 406

Query: 340 YVTGLSLXSXILKIQXFTIFIGVNXTFXPNIF 245
           +  GL     +  IQ + +FIGVN  F P  F
Sbjct: 407 F--GLMYNETLASIQFWILFIGVNIVFGPQHF 436



 Score = 37.5 bits (83), Expect = 0.001
 Identities = 16/21 (76%), Positives = 17/21 (80%)
 Frame = -3

Query: 453 LLDITXHDTYXVVAXFHYVLS 391
           +LDI  HDTY VVA FHYVLS
Sbjct: 369 VLDIAFHDTYFVVAHFHYVLS 389


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,391,143
Number of Sequences: 5004
Number of extensions: 18981
Number of successful extensions: 28
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 227943826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).