SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0009
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB1E7.02c |mcl1|slr3|DNA polymerase alpha accessory factor Mc...    30   0.28 
SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch...    27   2.6  
SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2 alpha-1,...    26   4.5  
SPAPB1A11.01 ||SPAPB24D3.11|membrane transporter|Schizosaccharom...    26   4.5  
SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces pombe...    25   7.9  
SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|S...    25   7.9  

>SPAPB1E7.02c |mcl1|slr3|DNA polymerase alpha accessory factor
           Mcl1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 815

 Score = 30.3 bits (65), Expect = 0.28
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 2/89 (2%)
 Frame = +1

Query: 214 C*SKSPNSTSRDKIVVETG-ENRQFIHINEPPIIVQEHDSQPQEKVCSTTKDVFWDRSKI 390
           C + +P++++   ++ E    N+ F+ + E  I   + D    EK+     +   D++ +
Sbjct: 704 CNTNNPDASTSVPVLEELQLRNKLFLTLLEDSI--GDGDVTEDEKISIARLEANIDKALL 761

Query: 391 RLLLKLCLEDRFKNINK-QKTLWHDIGIA 474
           +L+ K CLE+R + + +  KTL     IA
Sbjct: 762 QLIQKACLEERIERVYELTKTLRRTTSIA 790


>SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 684

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = -3

Query: 333 LAIMFLYDYRRFIYVDKLSIFSCFYYD 253
           L + F Y Y +F++V + S  S +YY+
Sbjct: 205 LKLFFRYQYSQFLFVYRESFLSDYYYN 231


>SPBC1734.12c |alg12||dolichyl pyrophosphate Man7GlcNAc2
           alpha-1,3-glucosyltransferase Alg12 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 546

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = -3

Query: 390 YFASIPKDVFSSTTNFFLWLAIMFLYDYRRFIYVDKLSIF 271
           YF  +P    + TT  FL ++ +++   R  IYV    IF
Sbjct: 254 YFVRLPWLFLNPTTLLFLLISFVYIKPARLLIYVPLFFIF 293


>SPAPB1A11.01 ||SPAPB24D3.11|membrane
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 495

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 9/25 (36%), Positives = 16/25 (64%)
 Frame = +2

Query: 23  PCNYVYKVFILNTILLFFRTLSCKY 97
           P  +  ++ I+NTI++ F T+ C Y
Sbjct: 30  PLTWPIRIRIINTIIISFMTMLCMY 54


>SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 568

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +1

Query: 547 KNRLGKEIQMGAYNTCEEVFKE-CKSLPSSFLETWGDPKVRKLLLLY 684
           +N + +E+   AY    E+FK+ CK     F +TWG  K  +  L Y
Sbjct: 507 RNWVLEEVIKEAYIGKFELFKKVCKMAACPFEDTWGFSKEEEDYLCY 553


>SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor
           Vma6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 905

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 10/37 (27%), Positives = 18/37 (48%)
 Frame = +1

Query: 529 YIRLLKKNRLGKEIQMGAYNTCEEVFKECKSLPSSFL 639
           Y+R+ K+ +  +    G Y+    +F E    PS+ L
Sbjct: 343 YLRITKREKALRSFSSGDYDLAMRLFSEISESPSTVL 379


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,911,704
Number of Sequences: 5004
Number of extensions: 60772
Number of successful extensions: 142
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 142
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).