SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0006
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC244.01c |sid4||SIN component scaffold protein Sid4 |Schizosa...    26   6.0  
SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr 1|...    25   7.9  
SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit S...    25   7.9  
SPBP4H10.04 |ppb1||calcineurin catalytic subunit Ppb1|Schizosacc...    25   7.9  

>SPBC244.01c |sid4||SIN component scaffold protein Sid4
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 660

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 9/20 (45%), Positives = 16/20 (80%)
 Frame = +3

Query: 393 LLLRQDYAPTRLSTSSTSPI 452
           L+ +QDY PT +ST+ ++P+
Sbjct: 356 LMNQQDYCPTTMSTTVSTPL 375


>SPAC24H6.03 |cul3|pcu3|cullin 3|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 785

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +2

Query: 266 DAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMS 382
           +AA+  +  +V + + HI    Q+I  +LKY D+V++ S
Sbjct: 116 EAAHRFLSSLVNSWKDHIV-SMQMISSVLKYLDKVYSKS 153


>SPBC1778.04 |spo6||Spo4-Spo6 kinase complex regulatory subunit
           Spo6|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 474

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 13/37 (35%), Positives = 16/37 (43%)
 Frame = +1

Query: 586 KSYCVAVWKATDDKAICLWEPHAVGPNGKNVFLXGRR 696
           K   V  W+ T D    LW   A+   G+  F  GRR
Sbjct: 265 KPIAVREWEKTLDSGEILWPSLAITAQGRCPFNTGRR 301


>SPBP4H10.04 |ppb1||calcineurin catalytic subunit
           Ppb1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 554

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +2

Query: 275 NSIMGIVVENIEPHIHWKPQLID 343
           N++M I   N  PH +W P  +D
Sbjct: 355 NNVMNIRQFNCSPHPYWLPNFMD 377


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,456,067
Number of Sequences: 5004
Number of extensions: 43374
Number of successful extensions: 101
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 99
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).