SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0005
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1718.07c |zfs1|moc4|transcription factor Zfs1 |Schizosacchar...    72   7e-14
SPBC13E7.02 |cwf24||GCN5-related N acetyltransferase|Schizosacch...    34   0.022
SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyce...    29   0.48 
SPAC25B8.14 |mal2||kinetochore protein Mal2 |Schizosaccharomyces...    28   1.1  
SPBC16C6.07c |rpt1||19S proteasome regulatory subunit Rpt1|Schiz...    27   2.0  
SPAC227.08c |yth1||zinc finger protein Yth1|Schizosaccharomyces ...    27   2.0  
SPAC1071.10c |pma1||P-type proton ATPase Pma1 |Schizosaccharomyc...    27   2.0  
SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces...    27   2.6  
SPCC1739.01 ||SPCC1906.05|zf-CCCH type zinc finger protein|Schiz...    27   2.6  
SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccha...    27   3.4  
SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr ...    27   3.4  
SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces...    26   4.5  
SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom...    26   6.0  
SPCC613.09 |sen54||tRNA-splicing endonuclease subunit Sen54 |Sch...    26   6.0  
SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces ...    25   7.9  

>SPBC1718.07c |zfs1|moc4|transcription factor Zfs1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 404

 Score = 72.1 bits (169), Expect = 7e-14
 Identities = 28/50 (56%), Positives = 37/50 (74%)
 Frame = +1

Query: 256 CQFAHGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEARR 405
           CQFAHG +EL+   RHPKYK+E CR+F   G+CPYG RC F+H+   A++
Sbjct: 347 CQFAHGNQELKEPPRHPKYKSERCRSFMMYGYCPYGLRCCFLHDESNAQK 396



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           YKTE C+ +   G C YG +C F H  +E +
Sbjct: 327 YKTEPCKNWQISGTCRYGSKCQFAHGNQELK 357



 Score = 27.9 bits (59), Expect = 1.5
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YKTE C+ ++ +G C+YG
Sbjct: 327 YKTEPCKNWQISGTCRYG 344



 Score = 26.2 bits (55), Expect = 4.5
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYG 250
           YK+E CR F   G C YG
Sbjct: 365 YKSERCRSFMMYGYCPYG 382


>SPBC13E7.02 |cwf24||GCN5-related N
           acetyltransferase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 533

 Score = 33.9 bits (74), Expect = 0.022
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +1

Query: 310 YKTELCRTFHSVGFCPYGPRCHFVHNAEE 396
           Y+ ++C+ +   G+C YG  C F+H  E+
Sbjct: 185 YQPDVCKDYKLTGYCGYGDTCKFLHMRED 213



 Score = 27.9 bits (59), Expect = 1.5
 Identities = 9/30 (30%), Positives = 16/30 (53%)
 Frame = +2

Query: 197 YKTELCRPFEEAGVCKYGDNANLLTASANY 286
           Y+ ++C+ ++  G C YGD    L    +Y
Sbjct: 185 YQPDVCKDYKLTGYCGYGDTCKFLHMREDY 214


>SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 522

 Score = 29.5 bits (63), Expect = 0.48
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +3

Query: 501 AAFPLTPHSPPAMSPPAQATAFAFRRTNS-PD 593
           +A+PL P+SPPA   PA +++ A  R  S PD
Sbjct: 248 SAWPLQPYSPPANETPASSSSSAKARPVSVPD 279


>SPAC25B8.14 |mal2||kinetochore protein Mal2 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 303

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 15/66 (22%), Positives = 30/66 (45%)
 Frame = +2

Query: 263 LLTASANYAIFSVILNTRRSCVALSIRLASVLMDRVAISCITQRKQDAENHRRQEVHWHR 442
           LL  + +  I    ++   SC  L I++  V+   +  S  + R   +  ++  + +W R
Sbjct: 213 LLQINKSLTIDGTNISANLSCTHLVIQIPKVIQATLVCSSESTRVVKSRIYQYSDENWKR 272

Query: 443 SHRADL 460
            HR +L
Sbjct: 273 DHRLEL 278


>SPBC16C6.07c |rpt1||19S proteasome regulatory subunit
           Rpt1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 438

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = -1

Query: 461 IDPPDESDANEPPGDDGSLRLASS 390
           +D  +E+D N PP D+G + L  S
Sbjct: 14  VDTEEENDKNPPPLDEGDIELLKS 37


>SPAC227.08c |yth1||zinc finger protein Yth1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 170

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +1

Query: 292 LQRHPKYKTELCRTFHSVGFCPYGPRCHFVH 384
           L   P  +  +C  ++++GFCP GP C   H
Sbjct: 100 LHLDPSKQVGVC-AWYNMGFCPLGPICRGKH 129


>SPAC1071.10c |pma1||P-type proton ATPase Pma1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 919

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = +3

Query: 522 HSPPAMSPPAQATAFAFRRTNSPDPEDDRLPVFNRLF 632
           H+P   +PP Q  A A       +P+DD   +   LF
Sbjct: 14  HAPEQQAPPPQQPAHAAAPAQDDEPDDDIDALIEELF 50


>SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3699

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 19/96 (19%), Positives = 39/96 (40%), Gaps = 1/96 (1%)
 Frame = -3

Query: 594  DRGSSCGEKRKLWPVLVATSQVESEASMEMRRAWRSRPVAHIRRHRSAR*ERCQ*TSWRR 415
            D+   C +K + W VL   ++ E  + + +  AWR    ++ R       +        R
Sbjct: 2657 DQWVMCAQKLQQWDVLTELAKHEGSSELLLECAWRISDWSNNRESLEVAIKSLSDVPTPR 2716

Query: 414  WFSASCFLCVMHEMA-TRSIRTEANRMESATQLRLV 310
              +  CF+ +   ++   +I+     +  A QL L+
Sbjct: 2717 KLTFQCFMTLQKSVSQPLAIKEFQQVLSEAIQLALI 2752


>SPCC1739.01 ||SPCC1906.05|zf-CCCH type zinc finger
           protein|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 547

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = +1

Query: 268 HGVRELRNLQRHPKYKTELCRTFHSVGFCPYGPRCHFVHNAEEAR 402
           +GV  ++NLQ  P      C+ F + G C  G  C F H+ E  R
Sbjct: 34  NGVSTVKNLQHVP------CKFFRN-GTCTAGENCPFSHSLETER 71


>SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 617

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 11/31 (35%), Positives = 12/31 (38%)
 Frame = +1

Query: 301 HPKYKTELCRTFHSVGFCPYGPRCHFVHNAE 393
           H K    LC        CPY   C F H+ E
Sbjct: 40  HVKENNALCPAISIGNECPYKENCKFPHDVE 70


>SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 377

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +1

Query: 325 CRTFHSVGFCPYGPRCHFVH 384
           CR +++ G C  G  C FVH
Sbjct: 209 CRYYNANGICGKGAACRFVH 228


>SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1639

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 4/40 (10%)
 Frame = +3

Query: 522 HSPPAMSPPA----QATAFAFRRTNSPDPEDDRLPVFNRL 629
           HSP   SP +       +F+F   +SP  ED+RL  F R+
Sbjct: 51  HSPILESPTSLNRQHRNSFSFNNVSSPSLEDERLINFPRV 90


>SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1692

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 8    GAIGPIGANSVSSGLSWEQHPVLSRASSVPAHRAL 112
            G I  +  +  +S L WE+HP+  R S++  H  +
Sbjct: 1329 GCIAMVFTDIKNSTLLWERHPIAMR-SAIKTHNTI 1362


>SPCC613.09 |sen54||tRNA-splicing endonuclease subunit Sen54
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 384

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 233 PLLQTVGRARSCSDLWLVAEEPVH 162
           PL +T+G A S + +WL+ EE ++
Sbjct: 103 PLFKTMGTADSQNRMWLLPEETLY 126


>SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 279

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 15/59 (25%), Positives = 25/59 (42%)
 Frame = +2

Query: 383 ITQRKQDAENHRRQEVHWHRSHRADLWRRI*ATGRDRHARRISIDASLSTCDVATSTGH 559
           +T+RK+D +++   E+H       DL+    AT     +     DA  S  D    T +
Sbjct: 53  VTERKEDTQDYNEPELHNSNDPTVDLYADTYATQAATESDSELEDALFSQLDEFDDTAY 111


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,638,439
Number of Sequences: 5004
Number of extensions: 49330
Number of successful extensions: 178
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 163
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 178
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).