SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0002
         (598 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC3A12.14 |cam1||calmodulin Cam1 |Schizosaccharomyces pombe|ch...    37   0.002
SPCC1682.04 |cdc31||centrin|Schizosaccharomyces pombe|chr 3|||Ma...    33   0.032
SPCC830.06 |||calcineurin regulatory subunit |Schizosaccharomyce...    31   0.17 
SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr ...    30   0.22 
SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr 1||...    28   1.2  
SPAC926.03 |rlc1||myosin II regulatory light chain |Schizosaccha...    27   2.1  
SPCC645.09 |mrpl37||mitochondrial ribosomal protein subunit L37|...    27   2.7  
SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizos...    26   3.6  
SPCC613.04c |rng3||UCS-domain protein |Schizosaccharomyces pombe...    26   4.8  
SPAC18B11.04 |ncs1||related to neuronal calcium sensor Ncs1|Schi...    25   6.3  
SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces...    25   8.4  
SPBC215.01 ||SPBC3B9.20|GTPase activating protein|Schizosaccharo...    25   8.4  
SPAC14C4.05c |mug61||Sad1 interacting factor|Schizosaccharomyces...    25   8.4  

>SPAC3A12.14 |cam1||calmodulin Cam1 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 150

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +3

Query: 309 FRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEF 467
           F+  D DG+  +  EE  + +   G  L++ E  ++  + DTD  G I+ +EF
Sbjct: 91  FKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADTDGDGVINYEEF 143



 Score = 28.7 bits (61), Expect = 0.68
 Identities = 14/60 (23%), Positives = 29/60 (48%)
 Frame = +3

Query: 321 DDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSES 500
           D DG+  +   E    ++  G     +E +++ ++ D D +G+I   EFL  +   M ++
Sbjct: 24  DQDGN--ITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTEFLTMMARKMKDT 81



 Score = 27.5 bits (58), Expect = 1.6
 Identities = 10/21 (47%), Positives = 16/21 (76%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDI 574
           V +AFK  DK G+G IT++++
Sbjct: 87  VREAFKVFDKDGNGYITVEEL 107


>SPCC1682.04 |cdc31||centrin|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 176

 Score = 33.1 bits (72), Expect = 0.032
 Identities = 16/56 (28%), Positives = 25/56 (44%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           R F   DDD +  ++        KE    ++  E E +  +FD D  G I+  EF+
Sbjct: 114 RAFELFDDDETGKISLRNLRRVAKELNENIDDQELEAMIEEFDLDQDGEINEQEFI 169



 Score = 31.1 bits (67), Expect = 0.13
 Identities = 17/76 (22%), Positives = 32/76 (42%), Gaps = 6/76 (7%)
 Frame = +3

Query: 297 LGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL-- 470
           +   F+  D D    ++  E    ++  G    KSE  ++   FD    G + +++F+  
Sbjct: 39  INEAFKLFDSDKDNAIDYHELRAAMRALGFNAEKSEVLKILRDFDKTGKGYLQMEDFVRV 98

Query: 471 ----IKIRPPMSESRR 506
               I  R P+ E +R
Sbjct: 99  MTEKIVERDPLEEIKR 114


>SPCC830.06 |||calcineurin regulatory subunit |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 174

 Score = 30.7 bits (66), Expect = 0.17
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +3

Query: 303 RIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEEL-FSQFDTDSSGSISLDEFLIKI 479
           R+F  +D+DG   ++ +EF+  +    +  NK E  +  F  +D D  G IS  E  + +
Sbjct: 60  RLFSVVDEDGGGDVDFQEFINSLSVFSVHGNKEEKLKFAFKIYDIDRDGYISNGELYLVL 119

Query: 480 RPPMSESRRK 509
           +  +  + R+
Sbjct: 120 KMMVGTNLRE 129


>SPAC15A10.08 |ain1||alpha-actinin|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 621

 Score = 30.3 bits (65), Expect = 0.22
 Identities = 14/51 (27%), Positives = 23/51 (45%)
 Frame = +3

Query: 294 GLGRIFRRMDDDGSKLLNKEEFLYGIKETGLELNKSEAEELFSQFDTDSSG 446
           G+ ++FR  +   S +LN+ EF   +   GL  +  E   LF +      G
Sbjct: 488 GITKVFRHFEKKKSNMLNEVEFYAALASLGLVYDTEEGTALFHRAANSEEG 538


>SPAC1F3.02c |mkh1||MEK kinase |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1116

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = -2

Query: 579  PLMSSIVIAPSPVLSSFLNACSTI-YDAIPTWED 481
            P+ S +V   SP    FLNAC T+  D  PT E+
Sbjct: 1054 PIPSELVSQVSPEAIQFLNACFTVNADVRPTAEE 1087


>SPAC926.03 |rlc1||myosin II regulatory light chain
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 184

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 512 VEQAFKKLDKTGDGAITIDDIKGCL 586
           +++AF  LDK GDG I  +D+K  L
Sbjct: 50  LKEAFALLDKDGDGNIGREDVKTML 74


>SPCC645.09 |mrpl37||mitochondrial ribosomal protein subunit
           L37|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 139

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = +1

Query: 346 TKKNSFMASRKQGWNLIKVKPKNSSVNSTQTVVAQSVLMNSLLKSVLP 489
           + +NS  +  K+ +   +V PK    NS  T  AQ V   +   SVLP
Sbjct: 32  SSRNSSSSLVKRSYVSSRVSPKKPQHNSDATSSAQKVANKTHTSSVLP 79


>SPAC22F8.11 |plc1||phosphoinositide phospholipase C
           Plc1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 899

 Score = 26.2 bits (55), Expect = 3.6
 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 2/30 (6%)
 Frame = +3

Query: 384 LELNKSEA--EELFSQFDTDSSGSISLDEF 467
           L LN S    EE F + D D SG +S +EF
Sbjct: 326 LHLNASMEFLEETFQKADADHSGKLSFEEF 355


>SPCC613.04c |rng3||UCS-domain protein |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 746

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 10/34 (29%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
 Frame = -2

Query: 366 HKGIL-LCSVVYFHHHPCDGKFFQVPRSLKHLGT 268
           H+G++ +C++VY        KF + P++++ L T
Sbjct: 686 HRGLVCICNIVYSKDQEIFNKFIKTPKAVETLRT 719


>SPAC18B11.04 |ncs1||related to neuronal calcium sensor
           Ncs1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 190

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 342 LNKEEFLYGIKETGLELNKSE-AEELFSQFDTDSSGSISLDEFL 470
           LNK EF    K+     + S  AE +F+ FD D +G I   EF+
Sbjct: 43  LNKSEFQKIYKQFFPFGDPSAFAEYVFNVFDADKNGYIDFKEFI 86


>SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +3

Query: 306 IFRRMDDDGSKLLNKEEFLYGIKETGL-ELNKSEAE 410
           IFRR+ D  S +  ++ FL+     G+ E+  +EAE
Sbjct: 377 IFRRLGDQFSAMFRRKAFLHWYTGEGMDEMEFTEAE 412


>SPBC215.01 ||SPBC3B9.20|GTPase activating
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 834

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +3

Query: 354 EFLYGIKETGLELNKSEAEELFSQFDTDSSGSISLDEFL 470
           E+  G+    +  + S    LF +FD   +GS+SL + +
Sbjct: 564 EWAKGLDAAAINNSSSFLRHLFLRFDKSMTGSLSLQDLV 602


>SPAC14C4.05c |mug61||Sad1 interacting factor|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 844

 Score = 25.0 bits (52), Expect = 8.4
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +3

Query: 396 KSEAEELFSQFDTDSSGSISLDEFLIKIRPPMSESRRK 509
           K++   LFS+     +G IS+ E   K  PP S S R+
Sbjct: 38  KAQLITLFSKLRRAKNGLISMTELQQKNVPPSSRSPRR 75


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,290,981
Number of Sequences: 5004
Number of extensions: 44360
Number of successful extensions: 180
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 165
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 179
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 260219058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).