SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0001
         (485 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    27   1.1  
SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su...    27   1.5  
SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces pomb...    27   2.0  
SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces pombe...    26   2.6  
SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo...    26   3.5  
SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Sch...    25   4.6  
SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S...    25   6.1  
SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    25   6.1  
SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit...    25   8.0  
SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit Rev3|Sch...    25   8.0  
SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch...    25   8.0  

>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1517

 Score = 27.5 bits (58), Expect = 1.1
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +2

Query: 269  LSPFPSDAPLTSMDVERALSFAPRRGTAVFKSSG 370
            LS FPSD   T   +ER+     R GTAVF+S+G
Sbjct: 1376 LSHFPSDIEDT---IERSHPRIARGGTAVFQSAG 1406


>SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase
           Sum3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 636

 Score = 27.1 bits (57), Expect = 1.5
 Identities = 13/37 (35%), Positives = 19/37 (51%)
 Frame = -1

Query: 335 ERSSTRALRPYSSEERRSGTETAXLQTPSQFSFGYGG 225
           ++ S  A      +E  S   ++  QTPS+FS  YGG
Sbjct: 37  DKPSAGAAPAVGDDESVSSRGSSRSQTPSEFSSNYGG 73


>SPCC569.01c |||DUF1773 family protein 5|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 323

 Score = 26.6 bits (56), Expect = 2.0
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -3

Query: 480 SVYLTRKTKNTVRTASYNIKRPVAXISQHPNHDSEQPP 367
           S+ LTRK +NT R+    +  PV  ++ +   +S  PP
Sbjct: 228 SIMLTRKLENTTRSDQGYLASPVPFLNGNEPANSGLPP 265


>SPCC569.03 |||DUF1773 family protein 4|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 396

 Score = 26.2 bits (55), Expect = 2.6
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -3

Query: 480 SVYLTRKTKNTVRTASYNIKRPVAXISQHPNHDSEQPP 367
           S+ LTRK +N VR+  +    PV  ++     D E PP
Sbjct: 301 SMMLTRKYENMVRSDMHYSAVPVPFLNGDEPRDYELPP 338


>SPAC343.11c |msc1||multi-copy suppressor of Chk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1588

 Score = 25.8 bits (54), Expect = 3.5
 Identities = 14/45 (31%), Positives = 21/45 (46%)
 Frame = -1

Query: 425 LSGQSPTFPNIRTTTANSLQSS*RPRCHDAERSSTRALRPYSSEE 291
           +S Q     N +T   NS +++       AE SST  + PY S +
Sbjct: 155 ISSQQKFHGNDKTLEKNSAKATINKSNSTAETSSTATVEPYDSND 199


>SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase
           Ubp14|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 775

 Score = 25.4 bits (53), Expect = 4.6
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -3

Query: 429 NIKRPVAXISQHPNHDSEQPP 367
           NI+R V  I  HP+   E+PP
Sbjct: 668 NIERAVDWILNHPDESFEEPP 688


>SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein
           Cap1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 551

 Score = 25.0 bits (52), Expect = 6.1
 Identities = 22/85 (25%), Positives = 34/85 (40%)
 Frame = -3

Query: 435 SYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNARSTSILVRGASLGNGDSVXSN 256
           ++N+ R V  ++          PELL+   P +   L   +     R A   N  S   +
Sbjct: 141 AFNLLRQVLSVALKAQKPDMDSPELLEFLKPIQSELLTITNIRDEHRTAPEFNQLSTVMS 200

Query: 255 AIAVLIWVWRLTDHLTTASNGSDSS 181
            I++L WV      L+  S   DSS
Sbjct: 201 GISILGWVTVEPTPLSFMSEMKDSS 225


>SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 534

 Score = 25.0 bits (52), Expect = 6.1
 Identities = 14/30 (46%), Positives = 16/30 (53%)
 Frame = -1

Query: 329 SSTRALRPYSSEERRSGTETAXLQTPSQFS 240
           SST    P SSE   S TE++ L  PS  S
Sbjct: 116 SSTSFFSPTSSEYTPSSTESSSLLDPSSVS 145


>SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF
            hand and WH2 motif |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1794

 Score = 24.6 bits (51), Expect = 8.0
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = -2

Query: 376  TASRALEDRGATTRSEAQRAL 314
            +AS  LEDR A  ++EAQR +
Sbjct: 1221 SASSNLEDRAARIKAEAQRRM 1241


>SPAC688.10 |rev3||DNA polymerase zeta catalytic subunit
           Rev3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1480

 Score = 24.6 bits (51), Expect = 8.0
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +1

Query: 13  SSGTSSIPKFHSSLQDLKQPSLQEPR 90
           S  T+S  K H S   LK+ S  EPR
Sbjct: 255 SDETNSFSKLHQSQFGLKEESSHEPR 280


>SPBC25B2.07c |mug164||microtubule-associated
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 501

 Score = 24.6 bits (51), Expect = 8.0
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = -3

Query: 462 KTKNTVRTASYNIKRPVAXISQHPNHDSEQPPELLKTAVPRRGAKLNAR-STSILVRGAS 286
           K  N VR +S   +RP + I+Q P      P  L   A  R  A ++ R S+SIL R A 
Sbjct: 385 KAANIVRPSSSINRRPPSSINQRP------PSNLRILAPSRSRATIHERPSSSILHRHAH 438

Query: 285 LGNGDSVXSNAIA 247
                S  +  +A
Sbjct: 439 SLTSSSFSTKTLA 451


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,812,673
Number of Sequences: 5004
Number of extensions: 29315
Number of successful extensions: 118
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 118
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 188065158
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).