BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0237.Seq (907 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|S... 29 0.91 SPAP8A3.07c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Schi... 28 1.6 SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces... 27 4.8 SPBC8D2.19 |mde3||serine/threonine protein kinase Mde3|Schizosac... 26 6.4 SPCC663.10 |||methyltransferase, DUF1613 family |Schizosaccharom... 26 6.4 SPAC22G7.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 8.5 SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr... 26 8.5 >SPAC25H1.09 |mde5|meu30, SPAC4A8.01|alpha-amylase homolog Mde5|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 29.1 bits (62), Expect = 0.91 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +2 Query: 221 DPRTVAGKYNLGHPFIKANYWRDCIPLVRDAYLANAQNWVWEED 352 DPR + Y + PF +++++ P+ +D L+ Q W+ ED Sbjct: 149 DPRNI--DYGIYRPFNQSSHYHPMCPIEQDKPLSLEQCWIGTED 190 >SPAP8A3.07c |||phospho-2-dehydro-3-deoxyheptonate aldolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 28.3 bits (60), Expect = 1.6 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +1 Query: 421 GRQGGIGKALMQYVQQRHPHLMLEVYQKNHRR*IFTRHRVFTLSIAHGRMK-PNY 582 G G +G A+ HPH ML V ++ TR T I G K PNY Sbjct: 200 GTDGTVGVAIDAIGATAHPHTMLGVTKQGLAAITMTRGNKDTFIILRGGKKGPNY 254 >SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces pombe|chr 3|||Manual Length = 693 Score = 26.6 bits (56), Expect = 4.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 1 VTQATTLSEIPTSTSASDALSKALKKRGFKFVGTTICYS 117 V TT SE+ T SD +K + ++G+T+CYS Sbjct: 548 VAGGTTFSELRTCYELSDKYNKDI------YIGSTVCYS 580 >SPBC8D2.19 |mde3||serine/threonine protein kinase Mde3|Schizosaccharomyces pombe|chr 2|||Manual Length = 559 Score = 26.2 bits (55), Expect = 6.4 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 4/72 (5%) Frame = -1 Query: 352 VFFPDPVLRVGKIGIPHQRNAVTPVIRFYKGMPQVVLSSHSSRIAG----SSERCASRIM 185 VFFP P +P + + P + G P S+R G + S + Sbjct: 321 VFFPLPPSASKSNSVPQKIS--NPKVEQNLGFPISREDKKSTRRVGWLKKNLSEFVSSVK 378 Query: 184 VYFPDSNSSQPH 149 FPDS+ SQPH Sbjct: 379 SVFPDSHGSQPH 390 >SPCC663.10 |||methyltransferase, DUF1613 family |Schizosaccharomyces pombe|chr 3|||Manual Length = 502 Score = 26.2 bits (55), Expect = 6.4 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 193 RIMVYFP--DSNSSQPHDHSPAHMPA 122 RI++Y P D + QP++H P + PA Sbjct: 131 RILMYLPHLDKSLEQPYNHLPYYHPA 156 >SPAC22G7.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 236 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 345 KKTVSFSVLSALWKADFWQ-RCLSHRRPSGR 434 ++TVS + A W FW+ + SH + GR Sbjct: 177 QRTVSLETIYATWIPTFWESKRKSHEKDEGR 207 >SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 537 Score = 25.8 bits (54), Expect = 8.5 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = +2 Query: 245 YNLGHPFIKANYWRDCIPLVRDAYLANAQNWVWEEDGKLLGFVSIMEGRFLAAM 406 Y +G+ Y + + L QNW++ D + G V+ E RFL ++ Sbjct: 344 YKMGYMGANLTYLNFLVGVTIVVMLQPIQNWLYRWDKRRHGGVARPEARFLISL 397 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,066,171 Number of Sequences: 5004 Number of extensions: 91655 Number of successful extensions: 216 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 458501510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -