BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0229.Seq (901 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 30 0.52 SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2... 27 2.7 SPBC776.10c |cog6||Golgi transport complex peripheral subunit Co... 27 3.6 SPAC644.12 |cdc5||cell division control protein Cdc5|Schizosacch... 26 6.3 SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual 26 6.3 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 29.9 bits (64), Expect = 0.52 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Frame = +2 Query: 479 PVPNSPYSESITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIAL 643 P+P P S++ H + + +L N I+L ++PLSP A+ P+PI L Sbjct: 170 PLPRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRL 229 >SPBC1711.12 |||serine peptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 683 Score = 27.5 bits (58), Expect = 2.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 301 GRPTKSWFPWWRTRWTPGMRGRXXFDV 221 G P SW W TRW P + F V Sbjct: 453 GGPQGSWTDSWSTRWNPAVFANAGFIV 479 >SPBC776.10c |cog6||Golgi transport complex peripheral subunit Cog6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 27.1 bits (57), Expect = 3.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 607 WRNSEEARTDRPFPTVAXLKWANGKL 684 ++N EAR PF + L W NG + Sbjct: 53 FKNEREARKQLPFEVFSDLIWTNGSI 78 >SPAC644.12 |cdc5||cell division control protein Cdc5|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 647 GKGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 543 GK + R SSLL + C AR W+ P ++ Sbjct: 25 GKNQWARISSLLVRKTPKQCKARWYEWIDPSIKKT 59 >SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +2 Query: 107 ITASAHRATSETTWASTHRRPAPRWSTATSHAKSTPXTYIEXXSSPH 247 + S + T STH P STAT+ P T PH Sbjct: 160 VNQSYSKGIDGTALPSTHANPVAAPSTATTQHTQLPKTSAVSHQKPH 206 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,515,313 Number of Sequences: 5004 Number of extensions: 70920 Number of successful extensions: 175 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 175 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 454497130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -