BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0226.Seq (742 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.17c ||SPAC56E4.01c|mitochondrial pyruvate dehydrogenase... 29 0.70 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 4.9 SPAC7D4.10 |vma13||V-type ATPase subunit H|Schizosaccharomyces p... 26 4.9 >SPAC10F6.17c ||SPAC56E4.01c|mitochondrial pyruvate dehydrogenase |Schizosaccharomyces pombe|chr 1|||Manual Length = 444 Score = 29.1 bits (62), Expect = 0.70 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 10/83 (12%) Frame = -3 Query: 653 LQIAWSIPATHLSNVCPYXLSMXVSATTMVVTCNGESGFDSGE----GA*ETVPHPRKAA 486 LQ+A S+ LS C S + ++ V C G+S GE G+ E +P R Sbjct: 193 LQVAASLLLPALSGSCALLTSYSAKSKSLQVACTGDSRAVLGECTPDGSWEAIPLSRDQT 252 Query: 485 G------AQITHSRHGEVVTKNN 435 G +++ GE V +NN Sbjct: 253 GMNPDEASRLEVEHPGEEVLRNN 275 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 26.2 bits (55), Expect = 4.9 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +1 Query: 397 LIPITRPRKSPVSLFFVTTSPCREWVICAPAAFL 498 +IPI + KS +SL F+T SPC + IC+ A L Sbjct: 45 IIPIAQ--KSNISLPFLTLSPC-SFTICSLRARL 75 >SPAC7D4.10 |vma13||V-type ATPase subunit H|Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 26.2 bits (55), Expect = 4.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 468 VGNLRACCLPWMWYRFSGSL 527 + N+R +PW Y+ SGSL Sbjct: 28 INNVRCVAIPWQGYQRSGSL 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,933,767 Number of Sequences: 5004 Number of extensions: 58042 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -