BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0219.Seq (930 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 29 0.71 SPBC3E7.16c |leu3|SPBC4F6.03c|2-isopropylmalate synthase|Schizos... 27 2.8 SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharom... 27 5.0 SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 26 6.6 SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase ki... 26 6.6 SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccha... 26 6.6 SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit... 26 8.7 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 29.5 bits (63), Expect = 0.71 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = -2 Query: 692 IFTYSHIKFGVIIVHNNYCCITQLHNFFTKKISFVYTMKRNVGNVK*HLCLQSFGLLT 519 I+ Y +I V+I H I + F + K + Y +N+G V+ L L S LT Sbjct: 614 IYIYYNINGLVLIEHFPISSILNVKQFASTKCDYFYMNIQNIGTVRFRLYLDSSKALT 671 >SPBC3E7.16c |leu3|SPBC4F6.03c|2-isopropylmalate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 27.5 bits (58), Expect = 2.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +3 Query: 417 VHLTNACTPLFRQ 455 VHL NAC+PLFR+ Sbjct: 140 VHLYNACSPLFRE 152 >SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 26.6 bits (56), Expect = 5.0 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 8/42 (19%) Frame = +1 Query: 727 LINYLLSKXDVKIHLGLLPCQIIWFGI--------WNIWQGF 828 +I L K V G L QI+W G WN WQGF Sbjct: 416 IIPRLTEKYKVSFLAGALDLQILWTGTLLALQNTTWNGWQGF 457 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 785 HGRSPRWIFTSXLLKR*FIKFYVTFLLNYNYIFTYSHIKFGVIIVHNN 642 +GR W+F L + IK + N Y+F S + GV++++N+ Sbjct: 570 NGRKLSWLFH---LSKGEIKARINPQTNVTYVFQVSTYQMGVLLLYNH 614 >SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase kinase Win1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1436 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 172 SNILILRKTSDSGKLPLKPSCYSEISHPLEP 264 SN+L +S S +P+K + +S + HP+ P Sbjct: 130 SNLLHPPTSSSSIPIPIKNAGHSNLDHPIRP 160 >SPCC16C4.08c |skb15||Shk1 kinase binding protein 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 341 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 122 WQFI*TCPDSFDNGITGAISSSSEKLAIVV 211 W + T S GITG SEKLA+ V Sbjct: 109 WLLVHTLKSSSHKGITGIAVHPSEKLALTV 138 >SPAC29A4.02c |||translation elongation factor EF-1 gamma subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 409 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 734 FIKFYVTFLLNYNYIFTYSHI 672 F+KF T++L +Y+ Y+HI Sbjct: 165 FLKFGATYVLTKSYLAKYTHI 185 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,752,965 Number of Sequences: 5004 Number of extensions: 76526 Number of successful extensions: 147 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 471335896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -