BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0215.Seq (900 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC24B10.07 |gad8||serine/threonine protein kinase Gad8 |Schizo... 30 0.39 SPCC4B3.01 ||SPCP25A2.01c|thiosulfate sulfurtransferase|Schizosa... 27 4.8 SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 27 4.8 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 27 4.8 SPCC1442.02 ||SPCC1450.18|DUF1760 family protein|Schizosaccharom... 26 6.3 SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pom... 26 6.3 SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Sch... 26 6.3 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 26 6.3 SPAC24C9.10c |mrp4||mitochondrial ribosomal protein subunit S2|S... 26 8.4 SPAC9G1.12 |cpd1||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 26 8.4 SPAC688.13 |scn1||TatD DNase family Scn1|Schizosaccharomyces pom... 26 8.4 >SPCC24B10.07 |gad8||serine/threonine protein kinase Gad8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 569 Score = 30.3 bits (65), Expect = 0.39 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = +3 Query: 366 GGKVTRGLLASDSSSTPARDSGSDNAEYLGEDENNDNQNSVVAPNPCKDFFVASAARMGI 545 G TRGL S SST +R S + + ED+ + Q++VV P + A + + Sbjct: 24 GSSFTRGLKNSTLSSTSSRKSSDEKSRKSSEDKRSP-QSTVVQPG-LLQVTIIEARNLKL 81 Query: 546 PS 551 PS Sbjct: 82 PS 83 >SPCC4B3.01 ||SPCP25A2.01c|thiosulfate sulfurtransferase|Schizosaccharomyces pombe|chr 3|||Manual Length = 298 Score = 26.6 bits (56), Expect = 4.8 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +3 Query: 423 DSGSDNAEYLGEDENNDNQNSVVAPNPCKDFFVASAARMGIPSDFQQLVY 572 +S A+Y DE D++N + P D F + ++GI + ++Y Sbjct: 50 ESRLPGAQYFDIDEAKDHKNPLPHMLPPADEFASYVGKLGIDRNTNVIIY 99 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 26.6 bits (56), Expect = 4.8 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -2 Query: 803 VTKTICYPGDAANRNQAYKILSENISMVKKNMPHV*NFDCSY*FPKSG 660 V TI P D RN++ + L N+ +K + H+ F PK G Sbjct: 89 VASTIGIPVDHRRRNRSEESLQRNVERIKVYLAHLIVFPRKAGQPKKG 136 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 26.6 bits (56), Expect = 4.8 Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Frame = -3 Query: 553 SDGIPILAAEATKKSLHG---LGATTEXXXXXXXXSPKYSALSDPLSLAGVLLLSEANNP 383 S G+P +AAEA + L+G L + S + LS L +L S+ NP Sbjct: 306 SKGLPKVAAEAIRNILYGPVPLDPNVKIAIVCFDRSVNFFNLSPNLEQPHMLAASDLENP 365 Query: 382 LVTFPPNL 359 V F L Sbjct: 366 FVPFSSGL 373 >SPCC1442.02 ||SPCC1450.18|DUF1760 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 562 Score = 26.2 bits (55), Expect = 6.3 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +3 Query: 450 LGEDENNDNQNSVVAPNPCKDFFVASAARMGIPSDFQQLVYLTTFATFI 596 L +D N + + V+PN D F A + D Q L Y+ F+ Sbjct: 464 LVKDSNEEGLKNFVSPNTLLDVFKVFDAMEDVELDSQSLSYIHQTLVFL 512 >SPBC17G9.11c |pyr1||pyruvate carboxylase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1185 Score = 26.2 bits (55), Expect = 6.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 818 RYGNCVTKTICYPGDAANRNQAYKILSENISMVKK 714 R G V T+CY GD N + Y L +++V K Sbjct: 702 RAGGVVEATMCYSGDMLNPKKKYN-LDYYVNLVDK 735 >SPAC13G6.01c |rad8|SPAC5H10.14c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1133 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 142 KVDELPDLDNLL-QCPVCYEIPTGHIFQCNEGHNVCG 249 K+D L + L+ +CP+C P + N H CG Sbjct: 863 KIDTLKSFEALITECPICCNEPIQNPLLLNCKHACCG 899 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 26.2 bits (55), Expect = 6.3 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +3 Query: 495 PNPCKDFFVASAARMGIPSDFQQLVYLTTFATFILQNF 608 P C DF + ++ P LVYLT F L + Sbjct: 631 PYDCYDFMIGASLCSHQPKFLLSLVYLTDLVLFFLDTY 668 >SPAC24C9.10c |mrp4||mitochondrial ribosomal protein subunit S2|Schizosaccharomyces pombe|chr 1|||Manual Length = 263 Score = 25.8 bits (54), Expect = 8.4 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 291 LFFGTRNYAMEELIANVRKLRAFKLGGKVTRGLLAS 398 LF GTRN + ++A ++ R + + + GLL + Sbjct: 112 LFIGTRNGQKDSVVAAAKRARGYHIFDRWLPGLLTN 147 >SPAC9G1.12 |cpd1||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 364 Score = 25.8 bits (54), Expect = 8.4 Identities = 12/60 (20%), Positives = 32/60 (53%) Frame = +3 Query: 318 MEELIANVRKLRAFKLGGKVTRGLLASDSSSTPARDSGSDNAEYLGEDENNDNQNSVVAP 497 ++E I +++++ ++ G R + + S+ A+ DN LGE++++ + + + P Sbjct: 254 IDEAIDRLKEVKRRRIEGFERRKMRREQNLSSDAKVEDQDNDSMLGENKSSVSTETALKP 313 >SPAC688.13 |scn1||TatD DNase family Scn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 25.8 bits (54), Expect = 8.4 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 709 CPMFEILIAVT-NFPRVVEICPCLKVFTAFCSSL*KFW 599 C +FE + + F R V + C++ + SSL KFW Sbjct: 165 CKVFEAQVRLAAEFQRAVSV-HCVQTYALLYSSLAKFW 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,844,495 Number of Sequences: 5004 Number of extensions: 82317 Number of successful extensions: 221 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 454497130 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -