BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0208.Seq (887 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 32 0.13 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 26 6.2 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 8.2 >SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 31.9 bits (69), Expect = 0.13 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 599 FWGRGAVKH*IGTLKGAPDLELDGESRRTW 688 +WGR +H +G L+G P+L +W Sbjct: 227 YWGRAIARHFVGQLRGGPNLTYSSVQNASW 256 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 26.2 bits (55), Expect = 6.2 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 342 PFXCATVGKGDRCGPLRYYXSWRKGDV 262 P C V G R GP Y +W+ DV Sbjct: 392 PKVCLFVRNGARLGPTSIYHAWKAFDV 418 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 8.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 396 VKSAHFLTNRPKSAKSLINQKNRP 467 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,204,965 Number of Sequences: 5004 Number of extensions: 60379 Number of successful extensions: 111 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -