SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo...    30   0.26 
SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos...    27   1.8  
SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple...    27   2.4  
SPAC1296.06 |||NADPH cytochrome reductase|Schizosaccharomyces po...    26   5.5  
SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk...    26   5.5  
SPAC227.04 |||autophagy C terminal domain family protein|Schizos...    26   5.5  
SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||...    25   7.3  
SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual      25   7.3  
SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    25   9.7  

>SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase
           Ubp12|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 979

 Score = 30.3 bits (65), Expect = 0.26
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 3/64 (4%)
 Frame = +2

Query: 236 EVVNFDDLDNFCRSHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPEREPE 406
           E+++F +        G   +  L   C+IN  W     LRL +L +   NQ S  E++ E
Sbjct: 245 EIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQKQE 304

Query: 407 KRLP 418
           KR+P
Sbjct: 305 KRVP 308


>SPAC2F7.07c |||histone deacetylase complex subunit Rco1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 607

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +1

Query: 439 RANYPLPAREVVTKNNDT 492
           +AN P+P  EVVT+NN T
Sbjct: 199 KANIPVPTSEVVTENNVT 216


>SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex
           subunit |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 442

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 12/36 (33%), Positives = 20/36 (55%)
 Frame = -1

Query: 290 VLDHAICKSYPDHQN*RLRTRGPPSIGFDLIKALIP 183
           ++D    K Y  H +  L  +  PS GF +I++L+P
Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426


>SPAC1296.06 |||NADPH cytochrome reductase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 558

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +2

Query: 221 EGLACEVVNFDDLDNFCRSHGQVPATHLSNVCLINFR 331
           E L C+V  F+D +    S G++ AT + N  + N +
Sbjct: 154 ESLGCKVKGFEDNNIVRHSRGKIEATLVHNKRISNIK 190


>SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 306

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -2

Query: 427 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 329
           P MW      P  N+ +   YP +PW S+ LPS
Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267


>SPAC227.04 |||autophagy C terminal domain family
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 179

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 9/22 (40%), Positives = 16/22 (72%)
 Frame = +2

Query: 191 VLLLDQNQSTEGLACEVVNFDD 256
           +L+L Q  S  G++CE++ FD+
Sbjct: 7   LLILAQKLSKGGISCELIEFDE 28


>SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 426

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 15/54 (27%), Positives = 30/54 (55%)
 Frame = -1

Query: 410 VSQAPSPESNLDSPLPVTTMVVAETTIES**GRHLKDASPVLDHAICKSYPDHQ 249
           +++  +P S + S LP  ++  A+TT+E    R L  +  ++D  IC ++  H+
Sbjct: 247 IAELYNPISCIKS-LPYLSLEEAKTTLEVHTDRSLFFSGQIIDFTICYTHNHHR 299


>SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 478

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 6/14 (42%), Positives = 11/14 (78%)
 Frame = -3

Query: 474 HYLPCREWVICAPA 433
           HY+PC+ W++  P+
Sbjct: 455 HYIPCQSWLVWYPS 468


>SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 338

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 11/35 (31%), Positives = 22/35 (62%)
 Frame = +1

Query: 79  NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 183
           N  IY+ +F  ++S++ + + I  L   +RT++SD
Sbjct: 14  NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,636,934
Number of Sequences: 5004
Number of extensions: 53781
Number of successful extensions: 122
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 122
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 122
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 299817502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).