SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ...    28   0.87 
SPAC343.01c |erg8||phosphomevalonate kinase |Schizosaccharomyces...    26   2.7  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    26   2.7  
SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar...    26   3.5  
SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1...    25   6.1  
SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos...    25   6.1  
SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyce...    25   6.1  

>SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor,
           zf-fungal binuclear cluster type |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 977

 Score = 27.9 bits (59), Expect = 0.87
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = -2

Query: 174 SICAQSAPSFTDW-KRAASGVRKSRT*LDNFILPERTSSVRLHFRY 40
           ++C + +  + DW +R +SG+++  T  +  I  ER   +  HF Y
Sbjct: 861 ALCDKMSEIWADWVQRTSSGIQEEDTIPNEMIDEERMLDLEKHFMY 906


>SPAC343.01c |erg8||phosphomevalonate kinase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 426

 Score = 26.2 bits (55), Expect = 2.7
 Identities = 14/48 (29%), Positives = 20/48 (41%)
 Frame = -1

Query: 325 GRTQLLDGSISLSPLYPVPTIDLQSESLRSSIRVSPDCDLTRHSSPSF 182
           G+  +  G I L P Y    I L ++   S+  +   C   R  SP F
Sbjct: 9   GKVLIAGGYIVLDPQYSGLVIGLTAKGYASTTTLDDKCGTVRVKSPQF 56


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.2 bits (55), Expect = 2.7
 Identities = 13/43 (30%), Positives = 20/43 (46%)
 Frame = +3

Query: 213 QSGETLMEDRSDSDCKSIVGTGYRGERLIEPSSSWVRPKFPSG 341
           Q G+ L +  ++     +VG G  GER      S+  P  P+G
Sbjct: 36  QKGKKLKKATTNDRSAPVVGGGVVGERKSNTPKSFAAPPVPTG 78


>SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large
            subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1689

 Score = 25.8 bits (54), Expect = 3.5
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +1

Query: 343  SWRRYKILKQSHPVKRMIRGIWAETTSTYSQ 435
            S + YK L Q + VK ++  + +ET S+Y++
Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112


>SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein
           Pop1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 775

 Score = 25.0 bits (52), Expect = 6.1
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%)
 Frame = -2

Query: 231 SGFPLTAT*PGIVHHLSGPSICAQSAPSFTDWKRAASG--VRKSRT*LDNFILPERTSSV 58
           +GFP   T   ++ HL  PS+CA S  S   +K  +S   + KS    D F      S +
Sbjct: 302 TGFPAEIT-NLVLTHLDAPSLCAVSQVSHHWYKLVSSNEELWKSLFLKDGFFWDSIDSKI 360

Query: 57  R 55
           R
Sbjct: 361 R 361


>SPAC926.09c |fas1||fatty acid synthase beta subunit
           Fas1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2073

 Score = 25.0 bits (52), Expect = 6.1
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = +3

Query: 438 FKWVRTPAYSNDEAGDL 488
           F  ++ P YS D+AGDL
Sbjct: 443 FSALKVPVYSTDDAGDL 459


>SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 536

 Score = 25.0 bits (52), Expect = 6.1
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = -2

Query: 153 PSFTDWKRAASGVRKSRT*LDNF 85
           P   DWKRAA+  +KS   L  F
Sbjct: 205 PRVEDWKRAAADYKKSSIPLGKF 227


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,936,297
Number of Sequences: 5004
Number of extensions: 38649
Number of successful extensions: 90
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 89
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 90
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 190087364
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).