SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr...    49   3e-07
SPCP31B10.06 |mug190||C2 domain protein |Schizosaccharomyces pom...    48   1e-06
SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc...    36   0.003
SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ...    33   0.018
SPCC1739.10 |mug33||conserved fungal protein|Schizosaccharomyces...    27   1.2  
SPBC16E9.11c |pub3||ubiquitin-protein ligase E3|Schizosaccharomy...    27   1.6  
SPAC26F1.13c |||leucine-tRNA ligase |Schizosaccharomyces pombe|c...    27   2.1  
SPAC343.11c |msc1||multi-copy suppressor of Chk1 |Schizosaccharo...    25   4.8  
SPBC36.11 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||M...    25   4.8  
SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi...    25   4.8  
SPAC22H10.11c ||||Schizosaccharomyces pombe|chr 1|||Manual             25   8.4  
SPCC736.06 |||aspartate-tRNA ligase|Schizosaccharomyces pombe|ch...    25   8.4  
SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe...    25   8.4  
SPAC3G9.04 |ssu72||phosphoric ester hydrolase |Schizosaccharomyc...    25   8.4  
SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po...    25   8.4  

>SPAPYUK71.03c |||C2 domain protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1225

 Score = 49.2 bits (112), Expect = 3e-07
 Identities = 30/75 (40%), Positives = 37/75 (49%), Gaps = 2/75 (2%)
 Frame = +1

Query: 262  LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF--SLPMS 435
            + V+V++ATDL   D NG SDPFV   L       Y T     TLNP + E F   LP  
Sbjct: 1039 MTVDVIKATDLPAADSNGKSDPFVVFELQGEEV--YRTKTHKRTLNPTFNESFEVELPCK 1096

Query: 436  GTVNEDSLCLEVWDF 480
             T N  +   + WDF
Sbjct: 1097 QTCNFVANVFD-WDF 1110



 Score = 32.3 bits (70), Expect = 0.042
 Identities = 18/74 (24%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + + +  A +L  K P    D +  I  MS+++ ++ T V +  +NP W+E+   P+   
Sbjct: 706 IRIHLRSANNLHSKIPGKKCDSYARI--MSHNTKQFRTVVIASNVNPFWDEYMYAPV--I 761

Query: 442 VNEDSLCLEVWDFD 483
              D   L+V +++
Sbjct: 762 TKHDIFFLQVMNYN 775


>SPCP31B10.06 |mug190||C2 domain protein |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1188

 Score = 47.6 bits (108), Expect = 1e-06
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (2%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM--SGT 441
           V +  A DL  +D NGLSD ++T+         Y T V    LNP+W E+  +P+     
Sbjct: 473 VHINRAEDLSKQDVNGLSDAYITVGFHKFGKPLYCTRVVKQDLNPIWNEYAFIPVFPDQV 532

Query: 442 VNEDSLCLEVWDFD 483
              + + +E+WD D
Sbjct: 533 KAGEKISIELWDSD 546


>SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 767

 Score = 35.9 bits (79), Expect = 0.003
 Identities = 21/77 (27%), Positives = 36/77 (46%)
 Frame = +1

Query: 247 ASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           A    + V +V A  L  +D     DPF  + +    +H   T++K  TLNP W E F +
Sbjct: 5   AQSRRIRVTIVAADGLYKRDVFRFPDPFAVLTVDGEQTHT-TTAIKK-TLNPYWNETFEV 62

Query: 427 PMSGTVNEDSLCLEVWD 477
                 +  ++ ++V+D
Sbjct: 63  ---NVTDNSTIAIQVFD 76


>SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1429

 Score = 33.5 bits (73), Expect = 0.018
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +1

Query: 319  SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAE 492
            SDPFV + L  N    + + V    LNPVW E   + +   V  D L L  +D+D  E
Sbjct: 1098 SDPFVVLKL--NGESAFKSKVIKKNLNPVWNEEADIVVQNRV-LDVLELVCYDWDMGE 1152


>SPCC1739.10 |mug33||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 336

 Score = 27.5 bits (58), Expect = 1.2
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +1

Query: 340 YLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVNED 453
           Y + NSS+ ++TS + G L    +     PM  T++ED
Sbjct: 198 YSLQNSSNIFSTSSRKGDLPKFSDYSAEKPMYDTISED 235


>SPBC16E9.11c |pub3||ubiquitin-protein ligase E3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 786

 Score = 27.1 bits (57), Expect = 1.6
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +1

Query: 274 VVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSL 426
           +V A  L  +D     DPF  + +    +H   T V   ++NP W E F +
Sbjct: 12  IVAADGLSKRDLFRQPDPFAILTVDGEQTH--TTKVIKKSVNPYWNEGFEV 60


>SPAC26F1.13c |||leucine-tRNA ligase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1111

 Score = 26.6 bits (56), Expect = 2.1
 Identities = 17/70 (24%), Positives = 31/70 (44%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           M  V   + T +V   P+   D F T+  +   +  Y+       LNP W ++ ++P+  
Sbjct: 405 METVLATKGTGVVTSVPSDSPDDFATLTELRKKAEFYH-------LNPEWMKYEAVPIIR 457

Query: 439 TVNEDSLCLE 468
           T +   +C E
Sbjct: 458 TPSYGDMCAE 467


>SPAC343.11c |msc1||multi-copy suppressor of Chk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1588

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -2

Query: 350 DIK*IVTNGSLRPF-GSLGTKSVASTTSTFSINPEAL*PPL 231
           DIK + T   L  F       S AST+S FS  PE+L  PL
Sbjct: 425 DIKLLNTLSPLETFFWCCSFPSTASTSSPFSYYPESLPTPL 465


>SPBC36.11 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 343

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 15/39 (38%), Positives = 20/39 (51%)
 Frame = +1

Query: 304 DPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           D N L+DPFVTI     SS+ +  S +    +    EHF
Sbjct: 308 DKNSLNDPFVTI---RKSSYEHEISEEHKKHSKKRSEHF 343


>SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase
           Lkh1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 690

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -1

Query: 156 PTSQPTSHPPTLC 118
           P S PTS+PP LC
Sbjct: 207 PYSSPTSYPPPLC 219


>SPAC22H10.11c ||||Schizosaccharomyces pombe|chr 1|||Manual
          Length = 629

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 8/23 (34%), Positives = 14/23 (60%)
 Frame = +2

Query: 8   LLDTDSEPDEHDKIGRIIEAVGW 76
           L+ +DS  D+HD     ++ +GW
Sbjct: 252 LISSDSSVDDHDNEQDDVDLIGW 274


>SPCC736.06 |||aspartate-tRNA ligase|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 611

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = -3

Query: 448 HSQCQTWVKK 419
           HSQ QTWVKK
Sbjct: 367 HSQLQTWVKK 376


>SPBC27B12.11c |||transcription factor |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 738

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 12/21 (57%), Positives = 12/21 (57%)
 Frame = -2

Query: 497 TVSAGSKSHTSKQRESSFTVP 435
           T SAGSK    K R  SFT P
Sbjct: 445 TSSAGSKPFNRKSRNRSFTNP 465


>SPAC3G9.04 |ssu72||phosphoric ester hydrolase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 197

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -2

Query: 107 KVFPSIVHQYSSQLPRLSVLSYHVH 33
           ++FPSI+  + S  P+L VL Y +H
Sbjct: 172 ELFPSIMADFQSNHPKLPVL-YTIH 195


>SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 937

 Score = 24.6 bits (51), Expect = 8.4
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = -1

Query: 279 DHLDIQHQPGGSLASALVRSCVCLSLP 199
           D  D+ +  GG+L S +V  C C+S P
Sbjct: 211 DRPDVVYMDGGNLKSTIV--CQCVSCP 235


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,123,218
Number of Sequences: 5004
Number of extensions: 41695
Number of successful extensions: 136
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 126
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 135
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 196153982
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).