SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe...    29   0.87 
SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce...    28   1.5  
SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ...    27   2.6  
SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F...    27   2.6  
SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos...    27   3.5  
SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M...    26   4.6  
SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos...    26   4.6  
SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schiz...    26   6.1  
SPCC1827.04 |||ankyrin repeat protein, unknown biological role|S...    25   8.1  
SPAC23C11.04c |pnk1||DNA kinase/phosphatase Pnk1|Schizosaccharom...    25   8.1  
SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|ch...    25   8.1  
SPAC2E12.02 |hsf1|hstf, hsf|transcription factor Hsf1|Schizosacc...    25   8.1  

>SPAC869.04 |||formamidase-like protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 410

 Score = 28.7 bits (61), Expect = 0.87
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = -3

Query: 547 ADRARNETDTTYG-RKIRGRPENAGPDPVRNVRRFSRV 437
           AD   + T  + G R I GRPEN G   ++N+ R S+V
Sbjct: 201 ADEKLSATVASEGARTIPGRPENGGNCDIKNLSRGSKV 238


>SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 351

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = -1

Query: 297 LRANPYSEVTDPICHFPYLHYSID*RLFTLETCCGYGYEPARHL 166
           L +     +  P   +P+   S+D R+F LE+  GY  EP   L
Sbjct: 144 LNSKTSESLKSPTLSYPFDLDSLDKRIFKLESKIGYADEPLSEL 187


>SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1420

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 16/48 (33%), Positives = 23/48 (47%)
 Frame = -1

Query: 354  TRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSID*RLFT 211
            +RP T P P P + + APV + +    V  PI   P  + +I    FT
Sbjct: 980  SRPRTAPIPEPEEQKKAPVEKKDAEKSVQAPIPAQPTGNITIQNAYFT 1027


>SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase
           Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 537

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 16/43 (37%), Positives = 25/43 (58%)
 Frame = -2

Query: 197 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 69
           A  GT++ +IST +P      P++VSGH     A R+P+  S+
Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412


>SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein
           glycosyltransferase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 450

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 5/60 (8%)
 Frame = +2

Query: 422 IYLI*HSRKSSYVSDWIRTRVLRPSADLPAVSRVGFVSCAI-----GTILYDRRSTVSSE 586
           +YL      S Y +D  RTR++ PSA +   +        +      T++Y+ R T++ E
Sbjct: 136 VYLTTLYLDSPYTTDLQRTRLILPSAKIDTYTTYNIDGAELPNRVGNTLVYESRETITGE 195


>SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 500

 Score = 26.2 bits (55), Expect = 4.6
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = -3

Query: 325 SRPNPTRPGPQSQSLFRSYGSNLPLPLPTLF 233
           S P P  P P +Q    ++G  L  P  T+F
Sbjct: 339 SNPRPANPQPYAQQRAGNFGDQLSEPSDTVF 369


>SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm
           type|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 473

 Score = 26.2 bits (55), Expect = 4.6
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -1

Query: 366 ARTSTRPGTGPHPLPVQTRHAPV 298
           A+ S  P   P PL +QTR AP+
Sbjct: 410 AQFSPYPAVAPSPLALQTRGAPI 432


>SPAC227.15 |||protein phosphatase regulatory subunit Reg1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 873

 Score = 25.8 bits (54), Expect = 6.1
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = -2

Query: 323 PSKPDTPRSSEPILIPKLRIQFATS 249
           P+ PD  R  +P + P LR+Q  T+
Sbjct: 260 PAAPDNERPLDPHITPYLRLQLLTT 284


>SPCC1827.04 |||ankyrin repeat protein, unknown biological
           role|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 600

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 18/50 (36%), Positives = 22/50 (44%)
 Frame = +2

Query: 386 VSILI*CGLKNCIYLI*HSRKSSYVSDWIRTRVLRPSADLPAVSRVGFVS 535
           +S  + C + N   L    RKS   SDW R    R    LP VS+  F S
Sbjct: 51  ISSCVNCQIDNLHTL--DERKSHIKSDWHRFNTKRKITKLPPVSQDEFES 98


>SPAC23C11.04c |pnk1||DNA kinase/phosphatase
           Pnk1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 421

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = -2

Query: 290 PILIPKLRIQFATSLTYIILSTRGSSPWRPAA 195
           P ++PKL+  +  + + +I S +   P +P+A
Sbjct: 100 PSVVPKLKALYQDNYSLVIFSNQNGIPRKPSA 131


>SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 244

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -2

Query: 545 RSRTKRNRHDLRQEDPRKAGERGSGSSPKRK 453
           R R +R+R  +R+E PR+  E      P+ K
Sbjct: 63  RDRYERHRESVREESPRRPVEHERNWQPELK 93


>SPAC2E12.02 |hsf1|hstf, hsf|transcription factor
           Hsf1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 609

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
 Frame = -2

Query: 569 NGGRTESCRSRTKRNRHDLRQEDPRKAGERGSGSSPKRK-TIFASVILNI 423
           NGG  +   S +  +      ++    G  GSGSS  RK T F++ + N+
Sbjct: 11  NGGTNQGMESSSANSPEMNGTQNSMSVGMSGSGSSQNRKITQFSNKLYNM 60


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,126,668
Number of Sequences: 5004
Number of extensions: 68399
Number of successful extensions: 194
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 183
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 194
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 331187010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).