SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schiz...    27   3.4  
SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccha...    27   3.4  
SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces ...    27   3.4  
SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein L13/L16|Schizos...    26   4.5  
SPAC328.06 |ubp2||ubiquitin C-terminal hydrolase Ubp2|Schizosacc...    26   4.5  
SPCC16C4.18c |taf50||histone H4-like TAF |Schizosaccharomyces po...    26   4.5  
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    25   7.8  

>SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein
           L13/L16|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 197

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = -3

Query: 572 KVTLFRASRLSGLHSEHILAGLARLASALEAFRHNPADGSSHHRPLGRVHEPNVR 408
           KV + R   L+ +        L  LA   +A R+NP+ G+ H R   R+ +  VR
Sbjct: 33  KVVVVRCEELN-ISGHFFRNKLKYLAYLRKACRYNPSRGAFHFRAPSRIFQKAVR 86


>SPBC839.13c |rpl1601||60S ribosomal protein
           L13/L16|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 197

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = -3

Query: 572 KVTLFRASRLSGLHSEHILAGLARLASALEAFRHNPADGSSHHRPLGRVHEPNVR 408
           KV + R   L+ +        L  LA   +A R+NP+ G+ H R   R+ +  VR
Sbjct: 33  KVVVVRCEELN-ISGHFFRNKLKYLAYLRKACRYNPSRGAFHFRAPSRIFQKAVR 86


>SPCC320.07c |mde7||RNA-binding protein Mde7|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 761

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +1

Query: 94  STHRDCESTAYRSFSIKSF*QEVPEKLPQG*LACGSQAFIATLLFDPSMSALPILRTNIR 273
           S   +C ++AY S S +      P   PQ      S++ IATL   PS+    +L  N+R
Sbjct: 120 SISNNCWNSAYNSNSFEGTGSS-PNFPPQNQFLSDSRSSIATLNAIPSLDQSVLLNPNLR 178


>SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein
           L13/L16|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 197

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 18/58 (31%), Positives = 26/58 (44%)
 Frame = -3

Query: 581 ATSKVTLFRASRLSGLHSEHILAGLARLASALEAFRHNPADGSSHHRPLGRVHEPNVR 408
           A  KV + R   L+ +        L  LA   +A R+NP+ G+ H R   R+    VR
Sbjct: 30  AGQKVVVVRCEELN-ISGHFFRNKLKYLAYLRKACRYNPSRGAFHFRAPSRIFTKAVR 86


>SPAC328.06 |ubp2||ubiquitin C-terminal hydrolase
           Ubp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1141

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 24/100 (24%), Positives = 44/100 (44%)
 Frame = -1

Query: 619 GLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDWLGWLRP*RRSGIIPRMVVRTTG 440
           G++ R+  +  E  L + H   P  S  +T S  +     W     +S I   +  R + 
Sbjct: 92  GIKDRIPVYYEEEELPEPHVTSPTKSEFATTSTCMK----WSSKTTKSEI--EVEWRDSY 145

Query: 439 RSAECMNQMSETAVPLVLSSITIATTSHQ*GKTNLSHDGL 320
             A C+ ++ ++  P   S +T  ++SHQ G ++ S   L
Sbjct: 146 LDANCIKEIIDSRRPSFASLLTKKSSSHQ-GSSHSSQPSL 184


>SPCC16C4.18c |taf50||histone H4-like TAF |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 452

 Score = 26.2 bits (55), Expect = 4.5
 Identities = 17/59 (28%), Positives = 29/59 (49%)
 Frame = -3

Query: 536 LHSEHILAGLARLASALEAFRHNPADGSSHHRPLGRVHEPNVRNCGSSRTEQYYYRNDK 360
           +HS+  +   A ++SAL      P  G ++ RPL   HE  V   G+ +   YY  +++
Sbjct: 51  VHSKRTVLTSADISSALRTLNVEPLYGFNNSRPL-EFHEAAV---GAGQNSLYYLDDEE 105


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1517

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = -1

Query: 109  SPYAY*TSGSSQLLPFCSTRGF 44
            SPYA+ T  S+ L PF STR +
Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,896,268
Number of Sequences: 5004
Number of extensions: 58619
Number of successful extensions: 143
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 139
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 143
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 321151040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).