SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c...    29   0.63 
SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe...    29   0.63 
SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|...    26   5.8  
SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr ...    26   5.8  
SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom...    25   7.7  

>SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1142

 Score = 29.1 bits (62), Expect = 0.63
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +1

Query: 37  SGCGRCRVWSMFVRYVRFSE 96
           +GCG+  VW  +VR+V F E
Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127


>SPAC869.04 |||formamidase-like protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 410

 Score = 29.1 bits (62), Expect = 0.63
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -3

Query: 221 ARKIRGRPENAGPDPVRNVRRFSRV 147
           AR I GRPEN G   ++N+ R S+V
Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238


>SPBC32F12.04 |tug1|gtb1|gamma-tubulin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 446

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -3

Query: 479 RIRARYPKRVIVTPAVYPRLLEFLHVDIQ 393
           R+  RYPK++I T +V+P       V +Q
Sbjct: 156 RLNDRYPKKIIQTYSVFPNSQSVSDVVVQ 184


>SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 495

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = -3

Query: 323 SRIPLVRASSELTVERRS-YRIVPSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFS 153
           + +   R  S+ +  RRS YR   S + ++ ++L+  K +  P  + P P+ N+ + S
Sbjct: 298 TNVTTFRRFSQSSYPRRSNYRRRISTSSKSLYELSPSKFKSIPITSNPPPMLNLSKGS 355


>SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 233

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -3

Query: 74  TNIDQTRHRPHPLPVQTRHAPV 9
           +N+D  +  PHP P Q    PV
Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,696,479
Number of Sequences: 5004
Number of extensions: 51346
Number of successful extensions: 136
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 134
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 136
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 315915086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).