SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe...    28   0.71 
SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce...    27   1.2  
SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce...    26   3.8  
SPBC646.12c |gap1|src1, sar1|GTPase activating protein Gap1|Schi...    25   5.0  
SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces pom...    25   8.7  
SPBC13G1.08c |ash2||Ash2-trithorax family protein|Schizosaccharo...    25   8.7  
SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ...    25   8.7  
SPAC824.09c |||GTPase activating protein |Schizosaccharomyces po...    25   8.7  
SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe...    25   8.7  

>SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 886

 Score = 28.3 bits (60), Expect = 0.71
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = -3

Query: 267 ISHLSTPLMSPYNARLESSSTGSAFPADSP 178
           +SH ST L  PYN    SSS+ S+  + SP
Sbjct: 81  VSHSSTILNEPYNESPSSSSSDSSSRSTSP 110


>SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1036

 Score = 27.5 bits (58), Expect = 1.2
 Identities = 29/101 (28%), Positives = 40/101 (39%), Gaps = 2/101 (1%)
 Frame = -3

Query: 477 SQTPRLAVSSNRITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPP--NRVSNETM 304
           S TP    SSN  T     ATS SATS      T+   P+      PL    +  +    
Sbjct: 251 SSTP--LTSSNSTT----AATSASATSSSAQYNTSSLLPSSTPSSTPLSSANSTTATSAS 304

Query: 303 KVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADS 181
              +    S    S  STPL S  +A   ++++ S+ P  S
Sbjct: 305 STPLTSVNSTTTTSASSTPLSSVSSANSTTATSTSSTPLSS 345


>SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 330

 Score = 25.8 bits (54), Expect = 3.8
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = -1

Query: 293 FSSDDRAKXSPTYLHLSCLLTMPD*SQAQQ 204
           FSS + A     YL L  LLT+PD S+  Q
Sbjct: 108 FSSANPASIDLAYLDLQKLLTLPDHSKETQ 137


>SPBC646.12c |gap1|src1, sar1|GTPase activating protein
           Gap1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 766

 Score = 25.4 bits (53), Expect = 5.0
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -2

Query: 298 SGFPATIARXDLPLIYTSHVSLQCQTRVK 212
           SG PAT    DLPLI  S  SL+  + +K
Sbjct: 529 SGHPATRVPLDLPLIADSVSSLKSMSLMK 557


>SPAC25B8.05 |||pseudouridylate synthase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 450

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +3

Query: 81  PRHLISDAHEWINEIPTVPIYYLAKPQP 164
           P  LI+D  + I ++PT PIY +A   P
Sbjct: 303 PASLINDLLD-IKKVPTKPIYDMASEYP 329


>SPBC13G1.08c |ash2||Ash2-trithorax family
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 652

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = +3

Query: 117 NEIPTVPIYYLAKPQP 164
           NE+PTVPI Y  KP P
Sbjct: 274 NEVPTVPIRY--KPPP 287


>SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 278

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 9/34 (26%), Positives = 17/34 (50%)
 Frame = -1

Query: 494 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHH 393
           D     + LP+ + P    +   K+ ++F P+HH
Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHH 181


>SPAC824.09c |||GTPase activating protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 320

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -3

Query: 255 STPLMSPYNARLESSSTGSAFPADSPK 175
           ST    PY A  + ++TGS+F AD  K
Sbjct: 251 STTSSQPYGAFHQPATTGSSFVADKWK 277


>SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 523

 Score = 24.6 bits (51), Expect = 8.7
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -1

Query: 374 HTVRPPILSTVHR--FRPTE*VMKQ*K*WFSSDDRAKXSPT 258
           H+  PP+LST H   +RP++ +    + + S       SPT
Sbjct: 317 HSKEPPLLSTAHHSAYRPSKNIHSMFQHFNSMKKNKNNSPT 357


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,125,103
Number of Sequences: 5004
Number of extensions: 42742
Number of successful extensions: 102
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 101
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 102
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 204242806
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).