SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa...    28   1.3  
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    25   7.1  
SPBP4H10.07 |||ubiquitin-protein ligase E3 |Schizosaccharomyces ...    25   9.3  

>SPAC637.08 |||iron-sulfur cluster assembly ATPase
           Nbp35|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 317

 Score = 27.9 bits (59), Expect = 1.3
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +2

Query: 374 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 508
           Y+C  +  +S G L  SED ++ W    K GLI+ F    + E+  Y
Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1517

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = -1

Query: 491  SPYAY*TSGSSQLLPFCSTRGF 426
            SPYA+ T  S+ L PF STR +
Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232


>SPBP4H10.07 |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 583

 Score = 25.0 bits (52), Expect = 9.3
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = -1

Query: 332 GSRGSFKRRRAFPPRHHSARLERNTVARRYYRPRTASAQP 213
           G+R     R AF  R+  + L RN+ + R   P    A P
Sbjct: 70  GNRDRTTERSAFRSRYRGSLLNRNSPSLRSLSPPATPATP 109


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,706,048
Number of Sequences: 5004
Number of extensions: 56729
Number of successful extensions: 134
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 134
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 289756512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).