SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23C4.18c |rad4|cut5, dre3|BRCT domain protein Rad4|Schizosac...    29   0.54 
SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor eIF...    27   2.9  
SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S...    27   2.9  
SPBC1718.07c |zfs1|moc4|transcription factor Zfs1 |Schizosacchar...    27   2.9  
SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccha...    25   8.8  
SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr 2...    25   8.8  
SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyce...    25   8.8  

>SPAC23C4.18c |rad4|cut5, dre3|BRCT domain protein
           Rad4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 648

 Score = 29.1 bits (62), Expect = 0.54
 Identities = 15/47 (31%), Positives = 28/47 (59%)
 Frame = -2

Query: 361 RFEFCQLRWDMT*VCKRHIVESIKRNFSAILQPKEAVLSLVVENCGV 221
           ++E+  L+W +  VC   + +SI+RN  A+L+P+   L +  E  G+
Sbjct: 151 KYEYA-LKWKINVVCVEWLWQSIQRN--AVLEPQYFQLDMPAEKIGL 194


>SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor
           eIF3c|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 918

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 8/16 (50%), Positives = 14/16 (87%)
 Frame = +1

Query: 499 TTAPDCIVNTLCMYLH 546
           TT PD ++++LC+YL+
Sbjct: 550 TTTPDILIHSLCVYLY 565


>SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase
            Tor2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2337

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 2/61 (3%)
 Frame = -1

Query: 290  KEFQRHSSTQRGGLEFSCG--ELWCKVERNLRVFPFLEVAQSTVNTGVNSDLVHSTRAGV 117
            K F +  +  +G L+ +     LW K   N  V   L V  STVN  +  D++    A +
Sbjct: 1689 KGFFKSIALSKGNLQDTLRLLNLWFKFGNNSNVINTLNVGISTVNIDIWLDVIPQLIARI 1748

Query: 116  H 114
            H
Sbjct: 1749 H 1749


>SPBC1718.07c |zfs1|moc4|transcription factor Zfs1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 404

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 11/16 (68%), Positives = 14/16 (87%)
 Frame = +1

Query: 79  NSTSSPQGYAGKWTPA 126
           NS+S+PQGYA  WTP+
Sbjct: 113 NSSSNPQGYA--WTPS 126


>SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 453

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = +1

Query: 235 PQLNSRPPLWVEE 273
           PQ N++PPLW+ E
Sbjct: 207 PQKNNKPPLWLYE 219


>SPBP19A11.02c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 244

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = -2

Query: 166 LTQGSIRTSFTVHALASTSRHSLVVTTLNSARPQPRNAANNS 41
           L   ++ T+    A   TS HS+  T + S  P P  + N++
Sbjct: 39  LPSANVTTTSFSSASTETSTHSVTSTNITSIVPPPSTSHNST 80


>SPAC4G8.13c |prz1||transcription factor Prz1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 681

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 16/63 (25%), Positives = 26/63 (41%)
 Frame = +2

Query: 11  QRVQHGSLLFAVIRCIPRLWSS*IQRRHHKAMPGSGRQRVYCERGPN*PLC*QSTVPPQE 190
           +++  G   FA + C  R        RH+K+  G    R   ERG   P   ++ V    
Sbjct: 619 EQLHTGIKAFACVTCNQRFARMDALNRHYKSEVGQNCLRTATERGIQVPPSRKTAVASTS 678

Query: 191 REK 199
           ++K
Sbjct: 679 KQK 681


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,501,389
Number of Sequences: 5004
Number of extensions: 51353
Number of successful extensions: 124
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 120
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 124
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 273658928
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).