SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC162.12 ||SPCC1753.06c|sequence orphan|Schizosaccharomyces po...    28   1.2  
SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ...    27   2.1  
SPCC1494.03 |||sequence orphan|Schizosaccharomyces pombe|chr 3||...    27   3.6  

>SPCC162.12 ||SPCC1753.06c|sequence orphan|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 451

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = -3

Query: 341 HHSARLERNTVRPPILSTAHRFRPTE*VMNNESSGFSATIAR--NDL 207
           + S RL   T+RP  L+ AH   P   ++NN S+    T  R  NDL
Sbjct: 50  NRSGRLGSVTMRPSALTRAHSQNPNSSLVNNSSAVSHLTKQRSLNDL 96


>SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 278

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 16/78 (20%), Positives = 33/78 (42%), Gaps = 1/78 (1%)
 Frame = -3

Query: 437 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILSTAHRFRPTE* 261
           D     + LP+ + P    +   K+ ++F P+HH  + +  ++ +P   +T      T+ 
Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTTTEAAANTKD 207

Query: 260 VMNNESSGFSATIARNDL 207
           +       +SA     DL
Sbjct: 208 IEEETMIEYSAQPVVRDL 225


>SPCC1494.03 |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 492

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 193 CSISGRSFRAIVAEKPLLSLFITY 264
           C +  R +RA VA+  +L+L ITY
Sbjct: 99  CILDSREYRAQVADAQILNLAITY 122


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,085,374
Number of Sequences: 5004
Number of extensions: 65233
Number of successful extensions: 156
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 156
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 341222980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).