SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0088
         (672 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3 |Schiz...    26   4.3  
SPCC4B3.03c |||DUF21 domain protein|Schizosaccharomyces pombe|ch...    25   7.5  
SPBC1198.06c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar...    25   7.5  
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    25   7.5  
SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce...    25   7.5  
SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharom...    25   9.9  
SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit Pa...    25   9.9  
SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo...    25   9.9  
SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ...    25   9.9  

>SPBC36.07 |iki3||RNA polymerase II elongator subunit Iki3
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1253

 Score = 26.2 bits (55), Expect = 4.3
 Identities = 13/59 (22%), Positives = 30/59 (50%)
 Frame = -2

Query: 419  FAKRWIVHPSKGNVSWV*TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGERPV 243
            F + ++V+  +  ++ V  +  +V   L    RC+  T   E  R+F +++  +GE+ +
Sbjct: 1159 FEEEYLVNSLRRLIARVEEIRPEVHRLLEALVRCNMTTQASELQRNFANVIGTIGEKVI 1217


>SPCC4B3.03c |||DUF21 domain protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 679

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 17/65 (26%), Positives = 26/65 (40%)
 Frame = +2

Query: 392 MGEQSNAWRILLRNDRKSRHRRIKKQRRYERLAATSQLSCGNFSGTSC*KLFILKDR*AV 571
           +GE ++ W  +L     S    + K +R   LAA       N   ++     +  DR  V
Sbjct: 401 VGENNDFWNRMLHRSHLSTMAALHKSQRSHDLAANEHAPILNPKNSALNPRLVTNDRVKV 460

Query: 572 LSQSL 586
            S SL
Sbjct: 461 KSPSL 465


>SPBC1198.06c |||mannan endo-1,6-alpha-mannosidase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 466

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +2

Query: 488 AATSQLSCGNFSGTSC 535
           AA ++  CG +SGTSC
Sbjct: 334 AAAAKQCCGGYSGTSC 349


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1517

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 579  SPYAY*TSGSSQLLPFCSTRGF 644
            SPYA+ T  S+ L PF STR +
Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232


>SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 568

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = -1

Query: 249 AGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 124
           A  A+  +A     A +AEA   E+ K+++  EP+++  +K+
Sbjct: 89  AAEAEAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKK 130


>SPAC1296.03c |sxa2||serine carboxypeptidase
           Sxa2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 507

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 7/24 (29%), Positives = 15/24 (62%)
 Frame = -3

Query: 97  FKTREATSKPIWIAEIDAIGFFLN 26
           ++T+E  +  IW+  I  +G++ N
Sbjct: 236 YETQEQITASIWVEHISKLGYYFN 259


>SPAC6F12.12 |par2|pbp2|protein phosphatase regulatory subunit
           Par2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 627

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 523 WHLLLKTLYTKGSIGRAFAVPMRTEH 600
           +H + + L   GSI   FAVP++ EH
Sbjct: 398 FHGIAELLEILGSIINGFAVPLKEEH 423


>SPAC23H3.02c |ini1||RING finger-like protein
           Ini1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 117

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +2

Query: 269 PNVRNCGSSRTEQYYYRNDKPSVG 340
           P V N GSSRT+ +Y R    + G
Sbjct: 86  PRVINLGSSRTDWFYERKKFKNAG 109


>SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 3655

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +2

Query: 515  NFSGTSC*KLFILKDR*AVLSQSL 586
            N  G S  KLFI+KD   V+SQ L
Sbjct: 3491 NIGGRSPQKLFIVKDSGQVMSQDL 3514


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,777,554
Number of Sequences: 5004
Number of extensions: 56264
Number of successful extensions: 158
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 153
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 158
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 307866294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).