SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe...    29   0.69 
SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schiz...    26   4.9  
SPAC8C9.06c |||mitochondrial translation regulator |Schizosaccha...    26   6.4  
SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst...    25   8.5  

>SPAC869.04 |||formamidase-like protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 410

 Score = 29.1 bits (62), Expect = 0.69
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -3

Query: 140 ARKIRGRPENAGPDPVRNVRRFSRV 66
           AR I GRPEN G   ++N+ R S+V
Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238


>SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 451

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 3/28 (10%)
 Frame = +3

Query: 216 NWHGQGESDCLIKQSIAMA---LAGVDA 290
           N HG   +DC+I  S A A   +AG+DA
Sbjct: 341 NTHGSKHTDCIITSSEAAANRFMAGIDA 368


>SPAC8C9.06c |||mitochondrial translation regulator
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 931

 Score = 25.8 bits (54), Expect = 6.4
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%)
 Frame = -2

Query: 267 SQCFV*LDSRIPLV--RASSELTVERRSYRI 181
           S CF   DSRIPLV  + S+  T++ R+Y +
Sbjct: 81  SPCFPNSDSRIPLVNWKTSTNPTLQVRAYML 111


>SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit
           Pst2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1075

 Score = 25.4 bits (53), Expect = 8.5
 Identities = 10/27 (37%), Positives = 19/27 (70%)
 Frame = -3

Query: 386 GYLKRVIVTPAVYPRLLEFLHVDIQST 306
           G+++R+ V    YP LLE+L++ + S+
Sbjct: 76  GFIERISVILRDYPDLLEYLNIFLPSS 102


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,990,077
Number of Sequences: 5004
Number of extensions: 60513
Number of successful extensions: 139
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 139
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 349251756
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).