SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo...    33   0.045
SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple...    27   1.7  
SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos...    27   1.7  
SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk...    26   5.2  
SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ...    25   6.8  
SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual      25   6.8  
SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||...    25   9.0  
SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    25   9.0  

>SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase
           Ubp12|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 979

 Score = 32.7 bits (71), Expect = 0.045
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +3

Query: 207 ASEVVNFDESG*LLQIHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 377
           + E+++F E    L   G   +  L   C+IN  W     LRL +L +   NQ S  E++
Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302

Query: 378 PEKRLP 395
            EKR+P
Sbjct: 303 QEKRVP 308


>SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex
           subunit |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 442

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -3

Query: 267 VLDHGSAKVIQIHQN*RLRTRGPPSIGFDLIKALIP 160
           ++D G  K   IH +  L  +  PS GF +I++L+P
Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426


>SPAC2F7.07c |||histone deacetylase complex subunit Rco1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 607

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 416 RANYPLPAREVVTKNNDT 469
           +AN P+P  EVVT+NN T
Sbjct: 199 KANIPVPTSEVVTENNVT 216


>SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 306

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -1

Query: 404 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 306
           P MW      P  N+ +   YP +PW S+ LPS
Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267


>SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 504

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = -3

Query: 402 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 301
           L ++  S+   P + PD P   T+  V+ TT+E+
Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455


>SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 478

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 6/14 (42%), Positives = 11/14 (78%)
 Frame = -2

Query: 451 HYLPCREWVICAPA 410
           HY+PC+ W++  P+
Sbjct: 455 HYIPCQSWLVWYPS 468


>SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1158

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = -1

Query: 503 YSFRLRGLVRVPYRYFSSLPPVPGVGNL 420
           YS RLR  ++  Y+Y   + P PG+ ++
Sbjct: 271 YSHRLRDSLKEVYQYRRIISPPPGLSSM 298


>SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 338

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 11/35 (31%), Positives = 22/35 (62%)
 Frame = +2

Query: 56  NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 160
           N  IY+ +F  ++S++ + + I  L   +RT++SD
Sbjct: 14  NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,513,786
Number of Sequences: 5004
Number of extensions: 51054
Number of successful extensions: 105
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 105
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 279695522
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).