SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase Rdh54...    26   5.0  
SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor Thi1|Sc...    25   6.6  
SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb...    25   6.6  
SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces...    25   8.8  
SPAC23H3.02c |ini1||RING finger-like protein Ini1|Schizosaccharo...    25   8.8  

>SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase
           Rdh54|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 811

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 536 WQPSVHSDVVFDPSMS 489
           W P  H DVV DP +S
Sbjct: 187 WDPRTHVDVVIDPFLS 202


>SPAC1486.10 |thi1|ntf1, SPAC6G10.01|transcription factor
           Thi1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 775

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 539 LWQPSVHSDVVFDPSMSALPI 477
           LW+  +HS VVFD S    P+
Sbjct: 488 LWKSDLHSSVVFDESAVQHPL 508


>SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1647

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 14/25 (56%), Positives = 18/25 (72%)
 Frame = -2

Query: 520 IATLFLILRCRLFLSLRSKIRQALD 446
           IATLF +L CRL  S+R  I +AL+
Sbjct: 617 IATLFELLECRLPDSVRICIVRALE 641


>SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 857

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 5/46 (10%)
 Frame = -2

Query: 163 DFTSR-----VSHSKRETRRRSPFGSRRSMLSVFFLTRASRLRRSG 41
           DF+SR         + + RRR P  SRR +       RA ++R SG
Sbjct: 5   DFSSRSLFLEAKEEEYKQRRRVPLDSRRRVRRACLSCRAKKIRCSG 50


>SPAC23H3.02c |ini1||RING finger-like protein
           Ini1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 117

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +3

Query: 312 PNVRNCGSSRTEQYYYRNDKPSVG 383
           P V N GSSRT+ +Y R    + G
Sbjct: 86  PRVINLGSSRTDWFYERKKFKNAG 109


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,591,525
Number of Sequences: 5004
Number of extensions: 52245
Number of successful extensions: 138
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 135
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 138
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 271646730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).