SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c...    27   2.3  
SPAC19B12.07c |||human ZNF277P homolog|Schizosaccharomyces pombe...    26   5.2  
SPAPB1E7.01c |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    25   6.9  
SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst...    25   6.9  
SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po...    25   9.1  

>SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 865

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -1

Query: 574 LRTPALFFDRCTAPVKLPAWQCLEP 500
           LRT    +DRC  P+K   W  +EP
Sbjct: 53  LRTKFNTYDRCIPPMKKSLWGWIEP 77


>SPAC19B12.07c |||human ZNF277P homolog|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 319

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -1

Query: 529 KLPAWQCLEPDHAGVLNGDERFRHVTTXHAWN 434
           K+ + QCL  ++ G+LN  E F H    H  N
Sbjct: 91  KIKSLQCLFCNNEGLLNRQEWFEHSFHVHGLN 122


>SPAPB1E7.01c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 163

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 5/43 (11%)
 Frame = +1

Query: 13  WPSRVLTQXKFLPSALNVNV-----KKFKQARVNGGSNYDSLK 126
           W +    + K LP AL   +     KK +  ++ GG N+D+LK
Sbjct: 68  WVTSKNEKLKSLPPALKKKIERQLQKKKEAEKIEGGKNHDNLK 110


>SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit
           Pst2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1075

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 10/27 (37%), Positives = 19/27 (70%)
 Frame = -2

Query: 132 GYLKRVIVTPAVYPRLLEFLHVDIQST 52
           G+++R+ V    YP LLE+L++ + S+
Sbjct: 76  GFIERISVILRDYPDLLEYLNIFLPSS 102


>SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 622

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -2

Query: 291 LQCQTRVKLNRVSFPADSPKPVPLAVVSL 205
           L+C+T   +N    P    KP+PL+ V L
Sbjct: 272 LECKTAKVVNITQKPKTKYKPLPLSTVEL 300


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,534,577
Number of Sequences: 5004
Number of extensions: 49396
Number of successful extensions: 111
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 108
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 281707720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).