SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1271.15c |||translation initiation factor IF-2Mt|Schizosacch...    27   1.7  
SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar...    26   5.2  
SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos...    25   9.1  
SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    25   9.1  

>SPBC1271.15c |||translation initiation factor
           IF-2Mt|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 686

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 16/58 (27%), Positives = 30/58 (51%)
 Frame = +2

Query: 452 LHSLIGNETPRECEITNVADNFILPERTSSVRLHFRYAFQFNVKNL*NS*LAHMLDSL 625
           L++ +G  T  + E    +D  I+    S  +  FR A + NVK L ++ + H++D +
Sbjct: 515 LYTGVGPVTETDIERAETSDAIIISFGVSVPKATFRLAEKHNVKLLFHNVIYHLMDDV 572


>SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large
            subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1689

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = -2

Query: 249  YKILKQSHPVKRMIRGIGAETTSTYSQ 169
            YK L Q + VK ++  + +ET S+Y++
Sbjct: 1086 YKSLIQKYKVKSVLSAVDSETASSYAK 1112


>SPAC926.09c |fas1||fatty acid synthase beta subunit
           Fas1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2073

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -1

Query: 166 FKWVRTPAYSNDEAGDL 116
           F  ++ P YS D+AGDL
Sbjct: 443 FSALKVPVYSTDDAGDL 459


>SPAPB1A10.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 529

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = +3

Query: 339 SICTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 443
           S  TS S ++SI  S   + + HSSPSF  + L S
Sbjct: 460 SPATSPSNQASIHASFTKESSTHSSPSFTLESLFS 494


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,672,667
Number of Sequences: 5004
Number of extensions: 55687
Number of successful extensions: 125
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 122
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 125
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 283719918
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).