SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo...    33   0.025
SPBC146.03c |cut3|smc4, smc4|condensin subunit Cut3|Schizosaccha...    30   0.30 
SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple...    26   3.7  
SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk...    26   4.9  
SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ...    25   6.5  
SPBC14C8.04 |||acetolactate synthase regulatory unit|Schizosacch...    25   6.5  
SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    25   8.6  

>SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase
           Ubp12|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 979

 Score = 33.5 bits (73), Expect = 0.025
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +1

Query: 205 ASEVVNFDESG*LLQIAGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 375
           + E+++F E    L   G   +  L   C+IN  W     LRL +L +   NQ S  E++
Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302

Query: 376 PEKRLP 393
            EKR+P
Sbjct: 303 QEKRVP 308


>SPBC146.03c |cut3|smc4, smc4|condensin subunit
           Cut3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1324

 Score = 29.9 bits (64), Expect = 0.30
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = +1

Query: 379 EKRLPHPRKAAGAQITHSRHGSFSGLPGPLGQGE 480
           E RL + +  AG QI    H SFS + GP G G+
Sbjct: 128 ELRLTNFKSYAGTQIVGPFHPSFSSIVGPNGSGK 161


>SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex
           subunit |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 442

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 13/36 (36%), Positives = 21/36 (58%)
 Frame = -2

Query: 265 VLDQRSAKVIQIHQN*RLRTRGPPSIGFDLIKALIP 158
           ++DQ   K   IH +  L  +  PS GF +I++L+P
Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426


>SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 306

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -3

Query: 402 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 304
           P MW      P  N+ +   YP +PW S+ LPS
Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267


>SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 504

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = -2

Query: 400 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 299
           L ++  S+   P + PD P   T+  V+ TT+E+
Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455


>SPBC14C8.04 |||acetolactate synthase regulatory
           unit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 289

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = -1

Query: 512 PPRATLKESACSPWPRGPGNPLKLPCREWVICAPAAFLGCGSRFSGSLS 366
           PPRAT+ E+  +     P N ++ P R    C      G  SR SG L+
Sbjct: 44  PPRATVPEAVSNIIMSTPFNRVQRPKRHVFNCLVQNEPGVLSRLSGILA 92


>SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 338

 Score = 25.0 bits (52), Expect = 8.6
 Identities = 11/35 (31%), Positives = 22/35 (62%)
 Frame = +3

Query: 54  NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 158
           N  IY+ +F  ++S++ + + I  L   +RT++SD
Sbjct: 14  NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,442,211
Number of Sequences: 5004
Number of extensions: 49540
Number of successful extensions: 102
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 99
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 102
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 266270664
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).