SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0055
         (465 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase ...    27   1.4  
SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr ...    26   3.3  
SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|ch...    25   5.7  
SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7 domain|Schizosaccharo...    25   5.7  
SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha...    25   7.5  
SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac...    24   9.9  

>SPBC26H8.03 |cho2||phosphatidylethanolamine N-methyltransferase
           Cho2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 905

 Score = 27.1 bits (57), Expect = 1.4
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -2

Query: 125 LEFHSQLPMRHFLQLALWLSYC 60
           LEF+S L  RHF+ L L   +C
Sbjct: 199 LEFNSWLVFRHFVDLILMCDFC 220


>SPBC3D6.03c |||tRNA endonuclease |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 678

 Score = 25.8 bits (54), Expect = 3.3
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 167 SNAEVFSYVHEINPKFILGPLLSFSLDS 250
           +N  + S V  +NP  ++ PLL  SLD+
Sbjct: 44  TNRIMLSVVSSLNPDSLIAPLLCVSLDN 71


>SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 577

 Score = 25.0 bits (52), Expect = 5.7
 Identities = 6/19 (31%), Positives = 13/19 (68%)
 Frame = -3

Query: 106 FQCVTSYNWLFGFPIVFEN 50
           F  V ++ W++G P+ F++
Sbjct: 360 FHSVANFGWIYGMPLFFQS 378


>SPAC4D7.01c |sec71|sec7a, SPAP8A3.15c|Sec7
           domain|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1811

 Score = 25.0 bits (52), Expect = 5.7
 Identities = 10/27 (37%), Positives = 20/27 (74%), Gaps = 1/27 (3%)
 Frame = +2

Query: 137 VFPSISDL-QLSNAEVFSYVHEINPKF 214
           V+ +++D+ QL+++ + SYVH  NP +
Sbjct: 582 VYHTLNDIPQLNSSTIGSYVHSHNPPY 608


>SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 496

 Score = 24.6 bits (51), Expect = 7.5
 Identities = 15/32 (46%), Positives = 19/32 (59%)
 Frame = +2

Query: 167 SNAEVFSYVHEINPKFILGPLLSFSLDSENKV 262
           SN E+FS++H I PK  L    S  LD E +V
Sbjct: 433 SNNELFSFIHNI-PKEFLHLSDSTYLDLEKQV 463


>SPCC736.14 |dis1||microtubule-associated protein Dis1
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 882

 Score = 24.2 bits (50), Expect = 9.9
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = +2

Query: 137 VFPSISDLQLSNAEVFSYVHE 199
           +F  I+DLQ+ NAE+   V+E
Sbjct: 718 LFREINDLQIQNAEMKEQVYE 738


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,646,528
Number of Sequences: 5004
Number of extensions: 28486
Number of successful extensions: 53
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 53
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 176367270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).