SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces p...    33   0.030
SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc...    29   0.64 
SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos...    27   2.6  
SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex lar...    27   2.6  
SPBPB2B2.05 |||GMP synthase [glutamine-hydrolyzing] |Schizosacch...    25   7.9  
SPAC4D7.08c |ade4|min13, aza1|amidophosphoribosyltransferase |Sc...    25   7.9  

>SPCC31H12.03c |||transcriptional regulator|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 245

 Score = 33.5 bits (73), Expect = 0.030
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +1

Query: 28  TRNPSPRQSSRASLEYLLLPPRSAPTEAPSGLTPRPFCALR-RARPTRYGLMIPN 189
           ++NP  R +SR+       PP+SAP++  S +   P  A + R R  R+G+   N
Sbjct: 191 SKNPQNRSNSRSKQRNKNAPPKSAPSKRKSNILDDPIEAEKARKRAERFGVAAKN 245


>SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 987

 Score = 29.1 bits (62), Expect = 0.64
 Identities = 24/74 (32%), Positives = 32/74 (43%)
 Frame = +3

Query: 465 PASSFE*AGVLTHLNLRIG*GRFGPNASNHSLYRMRLF*NFISTPAILRETSDGTSY*MV 644
           P+S FE      H +L +     GP  +NHS        + + T + LR  S       V
Sbjct: 138 PSSPFEDMQASVH-SLPLSGCSIGPVRTNHSSSLSNSSNSLLQTESSLRPNSS-----FV 191

Query: 645 RLVFRPIPSSDDRF 686
              F P+PSSDD F
Sbjct: 192 NSPFFPLPSSDDLF 205


>SPAC926.09c |fas1||fatty acid synthase beta subunit
           Fas1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2073

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -1

Query: 514 LKFKWVRTPAYSNDEAGDL 458
           L+F  ++ P YS D+AGDL
Sbjct: 441 LQFSALKVPVYSTDDAGDL 459


>SPBC4C3.05c |nuc1|rpa1|DNA-directed RNA polymerase I complex large
            subunit Nuc1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1689

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = -3

Query: 602  SWRRYKILKQSHPVKRMIRGIGAETTSTYSQ 510
            S + YK L Q + VK ++  + +ET S+Y++
Sbjct: 1082 SAKNYKSLIQKYKVKSVLSAVDSETASSYAK 1112


>SPBPB2B2.05 |||GMP synthase [glutamine-hydrolyzing]
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 237

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 8/21 (38%), Positives = 16/21 (76%)
 Frame = +2

Query: 230 RQNASAPSISGLVASAGESLH 292
           ++N+  P+I G++ + GES+H
Sbjct: 22  QRNSIPPNIDGIILAGGESVH 42


>SPAC4D7.08c |ade4|min13, aza1|amidophosphoribosyltransferase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 533

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 14/47 (29%), Positives = 18/47 (38%)
 Frame = +3

Query: 225 CIGKTLQRHPFQGWLLRQVSRCTLLSGFRLPWPPSCCHERPTPFMVS 365
           C G  +    F    LRQ+     +   R P   SC H    PF V+
Sbjct: 49  CKGSGMVADVFSQHQLRQLVGSMGIGHLRYPTAGSCAHSEAQPFYVN 95


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,028,757
Number of Sequences: 5004
Number of extensions: 63557
Number of successful extensions: 170
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 166
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 170
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 325165428
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).