SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyc...    29   0.74 
SPAC29A4.15 |||serine-tRNA ligase|Schizosaccharomyces pombe|chr ...    27   1.7  
SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple...    27   1.7  
SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster ...    27   2.3  
SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2 |Schizosacc...    27   2.3  
SPAC8C9.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||...    26   5.2  
SPAC24H6.05 |cdc25|sal2|serine/threonine protein phosphatase Cdc...    26   5.2  

>SPAC343.16 |lys2||homoaconitate hydratase Lys2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 721

 Score = 28.7 bits (61), Expect = 0.74
 Identities = 15/52 (28%), Positives = 31/52 (59%)
 Frame = -1

Query: 420 DGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNIQEDDL 265
           D  K + IL D +GAF ++  + D +T+    +  +SV++YN +  +++ D+
Sbjct: 317 DAIKASPILAD-EGAFYAKHLILDLSTLSPAVSGPNSVKVYNSAATLEKKDI 367


>SPAC29A4.15 |||serine-tRNA ligase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 450

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 4/44 (9%)
 Frame = +3

Query: 15  CGMRKQASSEKHAVMCLRRD-CSSG---CCLSDTFNLLDSICMP 134
           CG++K    EK  V CL    C++    CC+ + +   D + +P
Sbjct: 377 CGVKKMGDREKKYVHCLNSTLCATERALCCILENYQTPDGVNVP 420


>SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex
           subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1522

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +2

Query: 170 PVAHEELQPLEGSPAPVLERQPTVL 244
           P +H  +  +  SPA  +E+QPT+L
Sbjct: 117 PQSHPNVTVISASPARAIEQQPTIL 141


>SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster
           type |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 827

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = -3

Query: 289 AKHPGGRPPAPSLFTEYGRLALEDGGRTPFQ 197
           +K    +    SLF  YG+L+L+D G+  F+
Sbjct: 107 SKRSSSQDEFESLFDRYGQLSLKDDGKADFR 137


>SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 830

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 13/38 (34%), Positives = 22/38 (57%)
 Frame = +2

Query: 308 TDDSIVDRANTVAQSRTVDSLSKAPCVSSNIIATFSPS 421
           TDD       T  + R + +L+K+P + + IIA+ +PS
Sbjct: 458 TDDDFSLSRLTDDEEREIRALAKSPDIHNRIIASMAPS 495


>SPAC8C9.04 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 647

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
 Frame = +2

Query: 332 ANTVAQSRTVDSLSKAPCVSSNIIATFS---PSSSVALNISDHMSMPVVSLSEPPRQLKP 502
           A   A  R  + L  +P   ++  AT S   PSS V  N++   S P+ +  +   +LKP
Sbjct: 182 AEHFAPQRNDEQLGNSPASITSKPATTSAAQPSSKVEENMAKATSQPITTAEKEIPELKP 241


>SPAC24H6.05 |cdc25|sal2|serine/threonine protein phosphatase
           Cdc25|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 596

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +2

Query: 377 APCVSSNIIATFSPSSSVALN 439
           +P VSS I  +F P +S+ALN
Sbjct: 143 SPRVSSTIAYSFKPKASIALN 163


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,333,746
Number of Sequences: 5004
Number of extensions: 42426
Number of successful extensions: 135
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 134
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 135
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 283719918
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).